@TOME V3
(Apr 2019)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : A6FXB4_9DELT: (2019-01-26 )
MRSEALEQFVVEEAGVGAPRGASWSRVDEGQGANRVWRVRWGPGSSVIVKRCGPGRAFVQERRAATRWAPAVADASRGLGHARVLAASQALRCLVFVDAGRGEEQVALSPAAFACAGRYLARLHALPVDERDPVPLVEALARREARWLEGAPELRAVASSLGPGALADADWGPRVPCHRDFQPDNWLWDGRTLTVVDFEHARPDARALDLAKLWTRLDGDVDARANAAFWSAYLGPEPCSPSFLAQLRAGLVLHGLASVAWGRSHDDEAFVAEGERAVALARSGREPPNPRAGTPLASL

Atome Classification :

(20 SA) ------------------------------------.........10......----..20------------....-.....30-------..--.....-.40--------.--------.-......-50........60........70.-..-....-----------.80.......-------.------------90--...----......-100.....-----.-----------..-----110......-..120....----------------------------------.-.------.130..--.--------------.--...----------140.---...-....150-..---.------------------.----------.-------------------.-...-----160..----...---------------.---.-170----.-..-.....180.......---190---.........200.......210-...--.-----.-------.-------.----------------220...---..--------------.-.-230..-----..--...240-------..-...----.-...-250....-....260.--------..-.-------------.-----...270..------------...---------..280......--.290.......---------------
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) ------------------------------------MRSEALEQFVVEEAGVG----APR-------------GASW-SRVDEGQ-------GA--NRVWR-VRW--------G--------P-GSSVIV-KRCGPGRAFVQERRAATRWAPAV-AD-ASRG-----------LGHARVLAAS-------Q------------A---LRC----LVFVDA-GR-GEEQV-----A-----------LS-----P-AAFACAG-RYLARLHAL----------------------------------P-V------DERDPV--P--------------L--VEA----------LA-R---REA-RWLEG---AP---E------------------L----------R-------------------A-VAS-----SLGPG----ALA---------------D---A-DW-----G-PR-VPCHRDFQPDNWLWD---G-----RTLTVVDFEHARPDARALDLAK-LWT--R-----L-------D-------G----------------DVDARA---NA--------------A-F-WSAYL-----GP--EPCS---------PS-FLA----Q-LRA-GL-VLHG-LASVAW-G--------RS-H-------------D-----DEAFVAEG------------ERA---------VALARSGREPP--NPRAGTPLASL---------------
67 HHSearch 74.5714% -7 * C3 * - 2QG7 - ? D:[110-452] -------------------------------------------------------------------------SLEF-QIIN-GG--------T--NILIK-VKD--------M--------SKQAKYLI-RLYGPKTD---NREREKKISCIL-YN-KN-------------IA-KKIYVFF-------T------------N-----G----RIEEFMDGY-ALSRED----I-----------KN-----P-KFQKLIA-KNLKLLHDI----------------------------------K-L------NENLYK--ELQVTQKVPGT----R--PSF----------LW-N---TIW-KYFHL---LN---EERKKICSFDAKANILKLID----------F-------------------D-VLR-----DS-IV----EVE---------------SLC-KREN-----S-PI-VLCHCDLLSSNIINT---VG----DSISFIDFEYSCPMERAYDIAN-HFN--E-----Y-------AGFNCDWDL----------------TPSKEE---EY--------------H-F-IMHYL-----GT--DDEELI-------NQ-LIR----E-IQP-FY-ICSH-INWGLW-S--------LL-Q-------------GMHSS-DFDFINYG------------MTR---------LTASCLP--------------------------------
54 HHSearch 74.4521% -35 - C3 - - 3DXQ - ? B:[2-288] -------------------------------------MTDEARAKLAAIPMLA----G---------------YTGP-LERL-GG-------LT--NLVFR-A---------------------G-DLCL-RIP--------NRANEAVAAREA-AK-AG-------------VS-PEVLHVD-------P------------A---TGV----MVTRYIAGAQTMSPE-----KFK---------TR-----P-GSPARAG-EAFRKLHGS----------------------------------G-A------VFPFRF----------------------E----------LF-A---MID-DYLKV---LS---TKNVT--------------L----------PAGY----------------H-DVV-----RE-AG----GVR---------------SAL-AAHP-----L-PL-AACHCDPLCENFLDT---G-----ERMWIVDWEYSGMNDPLWDLGD-LSV--E-----G--------------------------------KFNANQ---DE--------------E-L-MRAYF-----GG--EA-R---------PA-ERG----R-VVI-YK-AMCD-LLWTLW-G--------LI-QLAN----------DNP---VDDFRAYA------------DGR---------FARCKALMETP----------------------------
53 HHSearch 74.2818% -5 - C3 - - 4R78 ? A:[23-303] ---------------------------------------KIIKEKISSLLSQE-----EE-------------VLSV-EQL--GG-------MT--NQNYL-AKT--------T--------N-K-QYIV-KFFGKGTEKLINRQDEKYNLELL-KD-LG-------------LDVKNYLFDI--------------------E---AGI----KVNEYIESAITLDS------T-----------SI-----K-TKFDKIA-PILQTIHTS----------------------------------A-K------ELRGEF----------------------A----------PF-E---EIK-KYESL---IE---EQIPYANYES---------V----------R-------------------N-AVF-----SL-EK----RLA---------------D-----LG-----V-DR-KSCHIDLVPENFIES---PQ----GRLYLIDWEYSSMNDPMWDLAA-LFL--E-----S--------------------------------EFTSQE---EE--------------T-F-LSHYE-----SD--QT-----------PV-SHE----K-IAI-YK-ILQD-TIWSLW-T--------VY-K-------------EEQ---GEDFGDYG------------VNR---------YQRAVKGLASY----------------------------
52 HHSearch 73.0018% -9 - C3 - - 4R7B - ? A:[23-303] ---------------------------------------KIIKEKISSLLSQE-----EE-------------VLSV-EQL--GG-------MT--NQNYL-AKT--------T--------N-K-QYIV-KFFGKGTEKLINRQDEKYNLELL-KD-LG-------------LDVKNYLFDI--------------------E---AGI----KVNEYIESAITLDS------T-----------SI-----K-TKFDKIA-PILQTIHTS----------------------------------A-K------ELRGEF----------------------A----------PF-E---EIK-KYESL---IE---EQIPYANYES---------V----------R-------------------N-AVF-----SL-EK----RLA---------------D-----LG-----V-DR-KSCHIDLVPENFIES---PQ----GRLYLIDWEYSSMNDPMWDLAA-LFL--E-----S--------------------------------EFTSQE---EE--------------T-F-LSHYE-----SD--QT-----------PV-SHE----K-IAI-YK-ILQD-TIWSLW-T--------VY-K-------------EEQ---GEDFGDYG------------VNR---------YQRAVKGLASY----------------------------
60 HHSearch 72.7317% -15 - C3 - - 1ZYL - SRKA_ECOLI A:[13-321] --------------------------------------PDTIMDALFE-HGIR----V---------------DSGL-TPL--NS-------YE--NRVYQ-FQD--------E--------D-RRRFVV-KFYRPERWTADQILEEHQFALQL-VN-DE-------------VPVAAPVAFNGQTLLNHQ------------G---FYF----AVFPSVGGR-QFEA------------------DN-----I-DQMEAVG-RYLGRMHQT----------------------------------G-R------KQLFIH--RPTI-----------G--LNE----------YL-I---EPR-KLFED---AT---LIPSGLKAA----------F----------L-------------------K-ATD-----EL-IA----AVT---------------AH--WRED-----F-TV-LRLHGDCHAGNILWR---D------GPMFVDLDDARNGPAVQDLWM-LLN--G-----D-------K------------------------AEQRMQ---LE--------------T-I-IEAYE-----EF--SEFD---------TA-EIG----L-IEP-LR-AMRL-VYYLAW-L--------MR-RWADPAFPKNFPWLT-----GEDYWLRQ------------TAT---------FIEQAKVLQEP--P-------------------------
51 HHSearch 72.6919% -35 - C3 - - 6EF6 ? A:[28-318] ---------------------------------------VTIAQQALTHYDVS----D---------------NASL-RLL--NL-------SE--NATYL-VED--------G--------E-H-QSIL-RVHRQDYHQPHEIESELDWLAAL-RTDSD-------------VTVPTVVPAR-------DGRRVVTVDPADVP---RHV----VHFEMVGGA-EPDEE-----S-----------LT-----L-DDFQTLG-RITASLHEH----------------------------------S-Q------RWTRPAGFGRF------------SWDWEH----------CL-GDTPRWG-RWQDA---EGVGAS------------------E----------T-------------------A-LLT-----RA-QDLLHRKLE---------------EY--GSGP-----D-RY-GLIHADLRLANLLVDS--STPQ--RTITVIDFDDCGFGWYFYDFGT-AVS--F-----I-------E-------HD---------------PRLGEW---QE--------------S-W-VAGYR-----SR--RELP---------AA-DEA----M-LPS-FV-FLRR-LLLLAW-M------------------------------------------------------------------------------------------------------
66 HHSearch 72.5114% -4 - C3 - - 2QG7 - ? E:[110-452] -------------------------------------------------------------------------SLEF-QIIN-G--------IT--NILIK-VKD--------M--------SKQAKYLI-RLYGPKTDEIINREREKKISCIL-YN-KN-------------IA-KKIYVFF-------T------------N-----G----RIEEFMDGY-ALSRED----I-----------KN-----P-KFQKLIA-KNLKLLHDI----------------------------------K-L------NENLYK--ELQVTQKVPGT----R--PSF----------LW-N---TIW-KYFHL---LN---EERKKICSFDAKANILKLID----------F-------------------D-VLR-----DS-IV----EVE---------------SLC-KREN-----S-PI-VLCHCDLLSSNIINT---VGG---DSISFIDFEYSCPMERAYDIAN-HFN--E-----Y-------AGFNCDWDL----------------TPSKEE---EY--------------H-F-IMHYL-----GT--DDEELI-------NQ-LIR----E-IQP-FY-ICSH-INWGLW-S--------LL-Q-------------GMHSS-DFDFINYG------------MTR---------LTASCLP--------------------------------
55 HHSearch 70.6521% -26 - C- - - 3DXQ - ? A:[2-288] -------------------------------------MTDEARAKLAAIPMLA----G---------------YTGP-LERL-GG-------LT--NLVFR-A---------------------G-DLCL-RIPGK----YINRANEAVAAREA-AK-AG-------------VS-PEVLHVD-------P------------A---TGV----MVTRYIAGAQTMSPE-----KFK---------TR-----P-GSPARAG-EAFRKLHGS----------------------------------G-A------VFPFRF----------------------E----------LF-A---MID-DYLKV---LS----NVT---------------L----------PAGY----------------H-DVV-----RE-AG----GVR---------------SAL-AAHP-----L-PL-AACHCDPLCENFLDT---G-----ERMWIVDWEYSGMNDPLWDLGD-LSV--E-----G--------------------------------KFNANQ---DE--------------E-L-MRAYF-----GG--EA-R---------PA-ERG----R-VVI-YK-AMCD-LLWTLW-G--------LI-QLAN----------DNP---VDDFRAYA------------DGR---------FARCKALMETP----------------------------
56 HHSearch 69.8819% 5 - C3 - - 3CSV ? A:[8-307] ----------------------------------------EIRDFLAT-HGYA--------------------DWNR-TP------------------RYQRLRS--------P--------T-GAKAVL-MDWSPEE--GGDTQPFVDLAQYL-RN-LD-------------ISAPEIYAEE-------H------------A---RGL----LLIEDLGDA-LFTEVINNDPA-----------QE-----M-PLYRAAV-DLLIHLHDA----------------------------------Q-T------PELARL--DPE------------T--LSE----------MTRL---AFS-EYRYA---IL---GDA----------------A----------E-------------------D-NRK-----RF-EH----RFA---------------QILSAQLE-----G-DM-VFVHRDFHAQNLLWL---PEREGLARVGVIDFQDAKLGHRAYDLVS-LLQ--D-----A-------R-------R----------------DVPAQV---EA--------------Q-M-IDHYI-----QA--TGVD---------ES-HFRSAYAV-IAV-QR-NMRI-LGIFAR-L--------SQRF-------------G-----KRHYIEFV------------PRV---------WAHFERGLAHP----------------------------
27 Fugue 69.2914% 12 - C3 - - 2QG7 - ? A:[50-458] YPITESNLRILEGEDRSEKAKELLKKYVSNVFENEKTLYIYCKYVMLHYGKDL----VNP-------------NEVDSLEFQIIN-------GT--NILIK-VKD--------M--------S-KQAKYL-IRLYGPTDEIINREREKKISCIL-YN---KN-----------IA-KKIYVFF-------T------------N---GRI----EEFMDG-YA-LSRED-----I-----------KN-----P-KFQKLIA-KNLKLLHDI----------------------------------K-L------NENLYK--E--------------L--QVTQKVPGTRPSFLW-N---TIW-KYFHL---LN---E------------------E----------RKKICSFDAKANILKLIDFDV-LRD-----SIVEV----ESL---------------C---K-RE-----NSPI-VLCHCDLLSSNIINTVGEG-----DSISFIDFEYSCPMERAYDIAN-HFN--E-----YAGFNCDWD-------L----------------TPSKEE---EY--------------H-F-IMHYL-----GT--D--D---------EE-LIN----Q-LIR-EIQPFYI-CSHINW-G--------LW-S-------------L-----LQGMHSFD------------FIN---------YGMTRLTASCL--PIFRSKV-------------------
40 SP3 68.1119% 7 - C3 - - 1NW1 - CKA2_CAEEL A:[32-426] ------------------------------------GMKELLSTMDLDTDANT----IPELKERAHMLCARFLGGAW-KTVPLEHLRISRIKGGMSNMLFL-CRLSEVYPPIRN--------E-PNKVLL-RVYFNPETESHLVAESVI---FT-LL-SERH-----------LG-PKLYGIF-------S------------G---GRL----EEYIPS-RP-LSCHE-----I-----------SL-----A-HMSTKIA-KRVAKVHQL----------------------------------E-V------PIWKEP--D--------------Y--LCE----------AL-Q---RWL-KQLTGTV-DA---E------------------H----------R-------------------FDLPE-----ECGVS----SVNCLDLARELEFLRAHIS---L-SK-----S-PV-TFCHNDLQEGNILLP---K-----R-LVLIDFEYASYNYRAFDFAN-HFIEWT-----I-------D-------Y----------------DIDEAP---FYKIQTENFPENDQMLE-F-FLNYLREQGNTR--ENEL---------YK-KSE----D-LVQ-ETLPFVP-VSHFFW-GVWGLLQVELS-P-------------V-----GFGFADYG------------RDR---------LSLYFKHKQ----------LLKNLA--------------
70 HHSearch 65.9217% -16 - C3 - - 1NW1 - CKA2_CAEEL A:[55-417] ----------------------------------------RAHMLCARFLGGAWKTVPLE-------------HLRI-SRIK-GG-------MS--NMLFL-CRL--------SEVYPPIRNE-PNKVLL-RVYFNPET-ESHLVAESVIFTLL-SE-RH-------------LG-PKLYGIF-------S-----------------GG----RLEEYIPSR-PLSCHE----I-----------SL-----A-HMSTKIA-KRVAKVHQL----------------------------------E-V------PIWKEP--D-------------------Y----------LC-E---ALQ-RWLKQ---LT---GTVDAEHRFD---------LPEECGVSSVNC-------------------L-DLA-----RE-LE----FLR---------------AHI-SLSK-----S-PV-TFCHNDLQEGNILLP---K------RLVLIDFEYASYNYRAFDFAN-HFI--E-----W-------T-------IDYDIDEAPFYKIQTENFPENDQ---ML--------------E-F-FLNYL-----RE--QGNTRENELYKKSED-LVQ----E-TLP-FV-PVSH-FFWGVW-G--------LL-Q-------------VELSPVGFGFADYG------------RDR---------LSLYFK---------------------------------
33 Fugue 65.5517% -2 - C3 - - 3CSV ? A:[4-333] ------------------------------------SREDEIRDFLAT------------------------------HGYADWN-------RT--PRYQR-LRS--------P--------T-GAKAVLMDWSPEEGGDTQPFVDLAQYLRN-------LD-----------ISAPEIYAEE-------H------------A---RGL----LLIEDL-GD-ALFTE-----V-----------INNDPAQEMPLYRAAV-DLLIHLHDA----------------------------------Q-TPELARLDPETLS--EM-------------T--RLA----------FS-E---YRY-AILGD---AA---E------------------D----------N-------------------R-KRF-----EHRFA----QIL---------------S---A-QL-----E-GDMVFVHRDFHAQNLLWL---PEREGLARVGVIDFQDAKLGHRAYDLVS-LLQ--D-----A-------R-------R----------------DVPAQV---EA--------------QMI-DHYIQ-----AT--GVDE---------SH-FRS----A-YAV-IA-VQRNMRILGIF-A--------RL-SQRF----------G-----KRHYIEFV------------PRV---------WAHFERGLAHP--ALASAAEEILNALPAPAPEVLERLRA
63 HHSearch 64.2017% -35 - C3 - - 2PPQ - KHSE_AGRFC A:[10-281] ---------------------------------------DELRNFLTQ-YDVG----S---------------LTSY-KGIA-E------------NSNFL-LHT--------T--------K-D-PLIL-TLYEK----KNDLPFFLGLMQHL-AA-KG-------------LSCPLPLPRK-------DGELLGELS----G---RPA----ALISFLEGM-WLRK------------------PE-----A-KHCREVG-KALAAMHLA----------------------------------S-E------GFEIKR--PNAL-----------S--VDG----------WK-V---LWD-KSEER---AD---EVEKG--------------L----------R-------------------E-EIR-----PE-ID----YLA---------------AH--WPKD-----L-PA-GVIHADLFQDNVFFLG--D-----ELSGLIDFYFACNDLLAYDVSI-CLN--A-----W-------C-------FEKDG------------AYNVTK---GK--------------A-L-LEGYQ-----SV--RPLS---------EA-ELE----A-LPL-LS-RGSA-LRFFLT-R--------L---------------------------------------------------------------------------------------------
28 Fugue 64.1314% -8 - C3 - - 2Q83 COTI_BACSU A:[11-346] ------------------------------------LSAEDAKKLTELAENVL----QGW-------------DVQA-EKIDVIQ-----------ALVWK-VHT--------D--------S-GAVCLK-RIHRPEKKALFSIFAQDYLAKKGMNV-PGIL-----------PNKKGSLYSK-------H------------G---SFL----FVVYDW-IE-GRP-F-----E-----------LT-----V-KQDLEFIMKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQMETWKLMA------EAEKED--P--------------F--SQL----------YL-Q---EID-GFIED---GL---R------------------I----------K-------------------D-RLL-----QSTYV----PWT---------------E---Q-LK-----K-SP-NLCHQDYGTGNTLLGE--N-----EQIWVIDLDTVSFDLPIRDLRKMIIP--L-----L-------D-------T----------------TGVWDD---ET--------------FNVMLNAYE-----SR--APLT---------EE-QKQ----VMFIDMLF-PYEL-YDVIRE-K--------YV-R-------------K-----SALPKEEL------------ESA---------FEYERIKANAL--RQLI----------------------
38 Fugue 63.2318% 1 - C3 - - 4OCV ? A:[24-378] -------------------------------------TNEALFDVA---SHFA----LEG-------------TVDS-IEPYGDG-------HI--NTTYL-VTT-----------------D-GPRYIL-QRMNTGI-FPDTVNLMRNVELVT-ST-LKAQGKETLDIVRTTSGDTWAEIDG-------G------------A---WRV----YKFIEH-TM-SYNLV-----P------------N-----P-DVFREAG-RAFGDFQNFLS--------------------------------G-F------DANQLT--ETIAHFHDTPHRFEDF--KKA----------LA-A---DELGRAAGC---GP---E------------------I----------E-------------------F-YLSHADQYAVVMD----GLR---------------D---G-SI-----P-LR-VT-HNDTKLNNILMDATTG-----KARAIIDLDTIMPGSMLFDFGD-SIR--FGASTAL-------E-------D----------------ERDLDKVHFST--------------E-L-FRAYT-----EGFVGELR---------DS-ITA----R-EAE-LL-PFSG-NLLTME-C--------GM-R-------------F-----LADYLEGDVYFATKYPEHNLVRS---------RTQIKLVREMEQRADETRAIVADVMETT-----------
58 HHSearch 63.0915% -41 - C3 - - 5IGI ? A:[11-300] ----------------------------------------QLYALAAR-HGLK----L---------------HGPL-TVNE-LG-------LD--YRIVI-ATV--------D--------D-GRRWVL-RIPRRAEV-SAKVEPEARVLAML-KN-R-LP-----------FAVPDWRVAN-------A------------ELVAYPMLEDSTA-VIQPGS-STPDWVVP--Q-----------DS-----E-VFAESFA-TALAALHAV----------------------------------P-I------SAAVDA--GMLIR----------T--PTQ----------AR-Q---KVA-DDVDR---VR---REFVV--------------N----------D-------------------K-RLH-----RW-QR----WLD---------------DD--SSWP-----D-FS-VVVHGDLYVGHVLID---NTE---RVSGMIDWSEARVDDPAIDMAA-HLM--V-----F-------G---------------------------EEG---LA--------------K-L-LLTYE-----AA--GGRVW--------PR-LAH----H-IAE-RL-AFGA-VTYALF-A--------LD-S-------------G-----NEEYLAAA------------KAQ---------LAAA-----------------------------------
25 Fugue 63.0816% 7 - C3 - - 1ZYL - SRKA_ECOLI A:[4-328] ----------------------------------SAFTFQTLHPDTIMDALFE----HGI-------------RVDS-GLTPLNS-------YE--NRVYQ-FQD--------E--------D-RRRFVV-KFYRPERWTADQILEEHQFALQL-VN-DEVP-----------VAAPVAFNGQ-------T------------L---LNHQGFYFAVFPS-VG-GRQFE-----A-----------DN-----I-DQMEAVG-RYLGRMHQTGRKQ------------------------------L-F------IHRPTI--G--------------L--NEY----------LI-E---PRK-LFEDATLIPS---G------------------L----------K-------------------A-AFL-----KATDE----LIA---------------A---V-TAHWREDF-TV-LRLHGDCHAGNILWR---D-----G-PMFVDLDDARNGPAVQDLWM-LLN--G-------------D-------K----------------AEQRMQ---LE--------------T-I-IEAYE-----EF--SEFD---------TA-EIG----L-IEP-LR-AMRL-VYYLAWLM--------RR-W-------------A-----DPAFPKNF------------PWLTGEDYWLRQTATFIEQAKVL--QEPPLQLTPMY---------------
50 HHSearch 62.8015% -44 - C3 - - 5UXD ? A:[8-298] ---------------------------------------DALLDLAARHGLDL----D---------------GGTL-RTEE-IG-------LD--FRVAF-ARA--------H--------D-GGDWVL-RLPRRPDV-LERAAVEGRLLAML-AP-H-LD-----------VAVPDWRIST------------------------SEL----IAYPLLPGS-PGLTV-----AADGEVSWHVDMAS-----T-VYARSLG-SVVAQLHAV----------------------------------D-A------EAAAAT--GIEVR----------S--PAQ----------VR-G---AWR-QDLAR---VG---AEFE---------------I----------A-------------------PALRE-----RW-EA----WLA---------------DD--GCWP-----G-HS-VLTHGELYPAHTLVED--E-----RITAVLDWTTAAVGDPAKDLMF-HQV--S-----A----------------------------------PSAI---FE--------------V-A-LQAYA-----EG--GGRP---------WPGLAR----H-CTE-MF-SAAP-LGYGLY-A--------LA-T-------------G-----EAAHREAA------------AAA---------LNPPE----------------------------------
57 HHSearch 60.9315% -34 - C3 - - 5IGH - ? A:[11-300] ----------------------------------------QLYALAAR-HGLK----L---------------HGPL-TVNE-LG-------LD--YRIVI-ATV--------D--------D-GRRWVL-RIPRRAEV-SAKVEPEARVLAML-KN-R-LP-----------FAVPDWRVAN-------A------------ELVAYPMLEDSTAMVIQPGS-STPDWVVP--Q-----------DS-----E-VFAESFA-TALAALHAV----------------------------------P-I------SAAVDA--GMLIR----------T--PTQ----------AR-Q---KVA-DDVDR---VR---REFVV--------------N----------D-------------------K-RLH-----RW-QR----WLD---------------DD--SSWP-----D-FS-VVVHGDLYVGHVLID---NTE---RVSGMIDWSEARVDDPAIDMAA-HLM--V-----F-------G---------------------------EEG---LA--------------K-L-LLTYE-----AA--GGRVW--------PR-LAH----H-IAE-RL-AFGA-VTYALF-A--------LD-S-------------G-----NEEYLAAA------------KAQ---------LAAA-----------------------------------