@TOME V3
(Feb 2022)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q5F650_NEIG1_: (2019-02-05 )
MQRQTELKNWLQTVYPERDFDLSFAAADADFRRYFRAAFSDGGSVVCMDAPPDKMSVAPYLKVQKLFDMVNVPQVLHADTDLGFVVLNDLGNTTFLTAMLQEQGEAAHKALLLEAIGELVGLQKASREGVLPEYDRETMLREINLFPEWFVAKELGRELTFKQRQLWQQTADTLLPPLLAQPKVYVHRDFIVRNLMLTRGRPGVLDFQDALYGPISYDLVSLLRDAFIEWEEEFVLDLVIRYWEKARAAGLPVPAEFDEFYRRFEWMGVQRHLKVAGIFARLYYRDGKDKYRPEIPRFLNYLRRVSRRYAELAPLYALLVELVGDEELETGFTF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_A_16(3CSV)
?
[Raw transfer]




43 HHSearch 84.7827% -17 - C7 -3CSV - ? -
1 PsiBlast_PDB 83.3028% -20 - C7 -3CSV 3.3 ?
28 Fugue 78.2326% -3 - C7 -3CSV - ? -
31 Fugue 64.7516% -4 - C7 -3ATS - Y3168_MYCTU -
37 Fugue 57.7814% -24 * C7 *2PPQ - KHSE_AGRFC -
32 Fugue 55.9015% 7 - C7 -1ZYL - SRKA_ECOLI -
29 Fugue 54.9214% -1 - C7 -2OLC - MTNK_BACSU -
64 HHSearch 51.5415% -31 - C7 -2PYW - MTK_ARATH -
52 HHSearch 48.2215% -8 - C7 -3C5I - ? -
68 SP3 47.1511% -6 - C7 -1NW1 - CKA2_CAEEL -
6 PsiBlast_PDB 46.7822% -64 - C7 -2PUN - MTNK_BACSU -
7 PsiBlast_PDB 46.4922% -71 - C7 -2PUP - MTNK_BACSU -
3 PsiBlast_PDB 46.3422% -63 - C7 -2PU8 - MTNK_BACSU -
53 HHSearch 45.9815% -45 - C7 -2PPQ - KHSE_AGRFC -
4 PsiBlast_PDB 45.9522% -67 - C7 -2PUI - MTNK_BACSU -
44 HHSearch 45.5916% -16 - C7 -6EF6 - ? -
2 PsiBlast_PDB 45.4322% -61 - C7 -2OLC - MTNK_BACSU -
5 PsiBlast_PDB 45.2422% -61 - C7 -2PUL - MTNK_BACSU -
39 Fugue 44.8314% 13 - C7 -3JR1 - ? -
35 Fugue 44.5413% -12 - C7 -3HAM - ? -