@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B3KWZ7_HUMAN: (2017-06-01 )
WNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(1PIC)

[Raw transfer]
-
GOL_A_3(5AUL)

[Raw transfer]



CHAIN_B_2(1H9O)

[Raw transfer]
-
ACE_B_3(1PIC)

[Raw transfer]
260 HHSearch 90.20100%-120 - C3 -5AUL 2.4
6 PsiBlast_PDB 89.7098%-120 - C3 -5AUL - -
4 PsiBlast_PDB 87.51100%-122 - C3 -1H9O 6.0
1 PsiBlast_PDB 82.96100%-134 - C3 -1BFI Calc...
2 PsiBlast_PDB 81.07100%-129 - C3 -1BFJ Calc...
258 HHSearch 80.9777%-133 - C3 -2Y3A Calc...
7 PsiBlast_PDB 80.9777%-133 - C3 -2Y3A - -
5 PsiBlast_PDB 78.82100%-116 - C3 -1PIC 4.3
3 PsiBlast_PDB 78.04100% - - C3 -1QAD Calc...
30 PsiBlast_CBE 67.7136% -44 - C3 -2IUI - P85A_HUMAN -
31 PsiBlast_CBE 67.3336% -52 - C3 -2IUH - KIT_HUMAN -
29 PsiBlast_CBE 67.0836% -47 - C3 -2IUI - -
16 PsiBlast_PDB 56.0438% -69 - C3 -5DC0 - ABL1_HUMAN -
13 PsiBlast_PDB 55.9938% -64 - C3 -3UYO - -
273 HHSearch 55.9039% -60 - C3 -5DC4 Calc...
259 HHSearch 55.8441% -91 - C3 -4EIH Calc...
14 PsiBlast_PDB 55.6538% -60 - C3 -5DC4 - -
8 PsiBlast_PDB 55.5940% -91 - C3 -4EIH - -
42 PsiBlast_CBE 55.5231% -58 - C3 -2LNW - -
256 HHSearch 55.1335% -84 - C3 -1JU5 Calc... CRK_HUMAN