@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : HCK_HUMAN: (2017-06-02 )
WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHY

Atome Classification :

(103 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1CSZ)

[Raw transfer]




ACE_I_3(1BHF)

[Raw transfer]




CC0_A_2(1IJR)
LCK_HUMAN
[Raw transfer]




787_B_2(1O4R)

[Raw transfer]




256_B_2(1O4Q)

[Raw transfer]




493_B_2(1O49)

[Raw transfer]




876_A_2(1O4B)

[Raw transfer]




791_B_2(1O4P)

[Raw transfer]




772_B_2(1O4H)

[Raw transfer]




852_B_2(1O44)

[Raw transfer]




UR2_A_2(1SKJ)

[Raw transfer]




687_B_2(1O45)

[Raw transfer]




CIT_B_2(1O4L)

[Raw transfer]




OXD_B_2(1O4N)

[Raw transfer]




843_B_2(1O42)

[Raw transfer]




262_B_2(1O4D)

[Raw transfer]




MLA_B_2(1O4M)

[Raw transfer]




299_B_2(1O4E)

[Raw transfer]




HPS_C_3(1O4O)

[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




1C5_A_2(1BKM)

[Raw transfer]




I59_A_2(1O4G)

[Raw transfer]




853_A_2(1O48)

[Raw transfer]




197_B_2(1O4A)

[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




PTC_C_5(1IS0)
SRC_RSVSA
[Raw transfer]




821_B_2(1O43)

[Raw transfer]




903_B_2(1O46)

[Raw transfer]




PTC_D_6(1IS0)

[Raw transfer]




PSN_B_2(1O4K)

[Raw transfer]




300_B_2(1O41)

[Raw transfer]




219_B_2(1O4I)

[Raw transfer]




GOL_A_4(4D8K)

[Raw transfer]




GOL_A_4(4D8K)

[Raw transfer]




IS2_A_2(1O4J)

[Raw transfer]




CC1_D_4(1FBZ)
?
[Raw transfer]




822_B_2(1O47)

[Raw transfer]




CC1_C_3(1FBZ)
LCK_HUMAN
[Raw transfer]




790_B_2(1O4F)

[Raw transfer]




CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A1A)

[Raw transfer]

-

CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_D_4(1A09)

[Raw transfer]

-

CHAIN_C_2(1A09)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1C)

[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_C_2(1A1B)
SRC_HUMAN
[Raw transfer]

-

CHAIN_C_3(1A1C)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A1B)

[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_D_4(1A1E)

[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_B_2(1SHA)

[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_3(1A1E)
SRC_HUMAN
[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1A08)

[Raw transfer]

-

CHAIN_C_2(1A08)
SRC_HUMAN
[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_C_2(1A1A)
SRC_HUMAN
[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

ACE_B_3(1LKL)
?
[Raw transfer]




CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_B_2(1SHD)

[Raw transfer]

-

CHAIN_B_2(1KC2)

[Raw transfer]

-

CHAIN_B_2(1SHB)

[Raw transfer]

-

CHAIN_D_4(1A07)

[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_D_2(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_A_1(1HCS)

[Raw transfer]

-

CHAIN_B_2(1F1W)

[Raw transfer]

-

CHAIN_A_1(1HCT)

[Raw transfer]

-

CHAIN_F_6(1SPS)

[Raw transfer]

-

CHAIN_E_4(1SPS)
SRC_RSVSA
[Raw transfer]

-

CHAIN_M_6(3PQZ)
GRB7_HUMAN
[Raw transfer]

-

CHAIN_D_4(1P13)
SRC_CHICK
[Raw transfer]

-

EDO_A_6(4U17)
FYN_HUMAN
[Raw transfer]




CHAIN_P_2(1AOT)

[Raw transfer]

-

CHAIN_C_2(1IS0)
SRC_RSVSA
[Raw transfer]

-

CHAIN_C_2(1A07)
SRC_HUMAN
[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_C_3(1P13)

[Raw transfer]

-

CHAIN_C_3(1NZV)

[Raw transfer]

-

CHAIN_D_4(1IS0)

[Raw transfer]

-

CHAIN_C_3(1NZL)

[Raw transfer]

-

EDO_A_6(4U17)
?
[Raw transfer]




CHAIN_P_2(1AOU)

[Raw transfer]

-

CHAIN_B_2(1JU5)
CRK_HUMAN
[Raw transfer]

-

13 PsiBlast_PDB 92.17100%-127 - C1 -3VS6 Calc... HCK_HUMAN
19 PsiBlast_PDB 88.84100%-134 - C1 -4U5W Calc... HCK_HUMAN
15 PsiBlast_PDB 88.07100%-123 - C1 -4LUD Calc... HCK_HUMAN
14 PsiBlast_PDB 88.02100%-105 - C1 -3VS7 Calc... HCK_HUMAN
1 PsiBlast_PDB 87.94100%-112 - C1 -1QCF Calc... HCK_HUMAN
9 PsiBlast_PDB 87.21100%-108 - C1 -3VS2 Calc... HCK_HUMAN
10 PsiBlast_PDB 86.97100%-109 - C1 -3VS3 Calc... HCK_HUMAN
37 PsiBlast_CBE 86.75100%-138 - C1 -4U5W Calc... HCK_HUMAN
12 PsiBlast_PDB 86.74100%-127 - C1 -3VS5 Calc... HCK_HUMAN
7 PsiBlast_PDB 86.57100%-123 - C1 -3VS0 Calc... HCK_HUMAN
21 PsiBlast_CBE 86.32100%-121 - C1 -4LUE Calc... HCK_HUMAN
18 PsiBlast_PDB 85.35100%-112 - C1 -2HCK Calc... HCK_HUMAN
16 PsiBlast_PDB 85.35100%-105 - C1 -4LUE Calc... HCK_HUMAN
20 PsiBlast_PDB 85.33100%-118 - C1 -3HCK Calc...
2 PsiBlast_PDB 85.14100%-122 - C1 -2C0I Calc... HCK_HUMAN
3 PsiBlast_PDB 84.92100%-100 - C1 -2C0O Calc... HCK_HUMAN
6 PsiBlast_PDB 84.08100%-107 - C1 -3VRZ Calc... HCK_HUMAN
47 PsiBlast_CBE 82.2575%-114 - C1 -1LKL 3.9 ?
41 PsiBlast_CBE 82.2475%-111 - C1 -1X27 5.6 ?
17 PsiBlast_PDB 82.09100%-104 - C1 -1AD5 Calc... HCK_HUMAN
44 PsiBlast_CBE 81.6875%-107 - C1 -1X27 6.1 ?
43 PsiBlast_CBE 81.5975%-121 - C1 -1X27 3.8 ?
51 PsiBlast_CBE 81.4475%-127 - C1 -1CWD 4.2 ?
42 PsiBlast_CBE 81.4275%-129 - C1 -1X27 5.8 ?
55 PsiBlast_CBE 81.3774%-138 - C1 -1FBZ 7.6 LCK_HUMAN
279 HHSearch 81.1776%-114 - C1 -1LKK 7.2 LCK_HUMAN
52 PsiBlast_CBE 80.9375%-114 - C1 -1LKK 7.2 LCK_HUMAN
53 PsiBlast_CBE 80.8874%-134 - C1 -1IJR 8.2 LCK_HUMAN
45 PsiBlast_CBE 80.7875%-121 - C1 -1X27 4.6
40 PsiBlast_CBE 80.3675%-120 - C1 -1X27 6.0 ?
285 HHSearch 79.6176%-118 - C1 -4D8K 1.9
38 PsiBlast_CBE 79.3975%-121 - C1 -1BHF 4.9
48 PsiBlast_CBE 79.3775%-118 - C1 -4D8K 1.9
39 PsiBlast_CBE 79.3475%-125 - C1 -1LCJ 4.8 LCK_HUMAN
50 PsiBlast_CBE 78.8375%-131 - C1 -1CWE 6.3 ?
54 PsiBlast_CBE 78.6174%-138 - C1 -1FBZ 7.6 ?
49 PsiBlast_CBE 77.9175%-139 - C1 -1CWE 5.4 ?
46 PsiBlast_CBE 76.0275%-117 - C1 -1LCK 3.5 LCK_HUMAN
70 PsiBlast_CBE 73.7757%-125 - C1 -1SHB 3.8
72 PsiBlast_CBE 72.8857%-135 - C1 -1NZV 6.3
74 PsiBlast_CBE 72.6057%-132 - C1 -1NZL 6.6
126 PsiBlast_CBE 72.4154%-147 - C1 -1KC2 6.2
102 PsiBlast_CBE 71.9455%-121 - C1 -1O44 8.3
101 PsiBlast_CBE 71.3055%-123 - C1 -1O45 7.4
95 PsiBlast_CBE 71.2955%-112 - C1 -1O4B 5.9
62 PsiBlast_CBE 71.2357%-127 - C1 -1IS0 4.1
109 PsiBlast_CBE 70.7055%-118 - C1 -1HCT 2.8
91 PsiBlast_CBE 70.6855%-128 - C1 -1O4I 2.4
92 PsiBlast_CBE 70.5855%-124 - C1 -1O4H 3.7
65 PsiBlast_CBE 70.5857%-145 - C1 -1P13 5.3 SRC_CHICK
121 PsiBlast_CBE 70.5755%-121 - C1 -1A07 3.5
89 PsiBlast_CBE 70.5455%-128 - C1 -1O4K 3.5
98 PsiBlast_CBE 70.3555%-116 - C1 -1O48 8.4
78 PsiBlast_CBE 70.3057%-125 - C1 -1F1W 5.7
87 PsiBlast_CBE 70.0555%-124 - C1 -1O4M 3.1
71 PsiBlast_CBE 69.9857%-129 - C1 -1SHA 4.7
103 PsiBlast_CBE 69.9655%-119 - C1 -1O43 6.3
90 PsiBlast_CBE 69.9155%-124 - C1 -1O4J 2.8
100 PsiBlast_CBE 69.6355%-119 - C1 -1O46 8.1
122 PsiBlast_CBE 69.5355%-128 - C1 -1A07 3.5 SRC_HUMAN
94 PsiBlast_CBE 69.5355%-124 - C1 -1O4D 2.4
82 PsiBlast_CBE 69.4955%-126 - C1 -1O4R 5.7
64 PsiBlast_CBE 69.3057%-140 - C1 -1P13 4.9
129 PsiBlast_CBE 69.2155%-123 - C1 -1O4G 3.8
108 PsiBlast_CBE 69.1655%-150 - C1 -1SHD 6.1
120 PsiBlast_CBE 69.1255%-125 - C1 -1A08 5.7 SRC_HUMAN
88 PsiBlast_CBE 69.0955%-125 - C1 -1O4L 3.9
63 PsiBlast_CBE 69.0957%-137 - C1 -1IS0 4.6 SRC_RSVSA
113 PsiBlast_CBE 69.0455%-122 - C1 -1A1C 6.7
105 PsiBlast_CBE 69.0055%-125 - C1 -1O41 2.7
104 PsiBlast_CBE 68.8555%-117 - C1 -1O42 7.3
119 PsiBlast_CBE 68.7955%-125 - C1 -1A08 6.3
67 PsiBlast_CBE 68.7757%-137 - C1 -1SPS 4.5 SRC_RSVSA
86 PsiBlast_CBE 68.7555%-123 - C1 -1O4N 3.4
83 PsiBlast_CBE 68.5155%-127 - C1 -1O4Q 3.5
118 PsiBlast_CBE 68.4955%-134 - C1 -1A09 5.7 SRC_HUMAN
115 PsiBlast_CBE 68.3055%-128 - C1 -1A1B 5.9
117 PsiBlast_CBE 68.1355%-130 - C1 -1A09 5.3
96 PsiBlast_CBE 68.0955%-114 - C1 -1O4A 7.0
84 PsiBlast_CBE 68.0555%-118 - C1 -1O4P 5.2
85 PsiBlast_CBE 67.8055%-114 - C1 -1O4O 3.0
97 PsiBlast_CBE 67.6555%-117 - C1 -1O49 6.8
99 PsiBlast_CBE 67.6155%-113 - C1 -1O47 7.7
79 PsiBlast_CBE 67.6056%-130 - C1 -1BKM 6.8
112 PsiBlast_CBE 67.5555%-136 - C1 -1A1E 6.2 SRC_HUMAN
66 PsiBlast_CBE 67.5357%-119 - C1 -1SPS 5.2
93 PsiBlast_CBE 67.4855%-128 - C1 -1O4E 3.4
130 PsiBlast_CBE 67.4655%-130 - C1 -1O4F 2.5
116 PsiBlast_CBE 67.3255%-125 - C1 -1A1B 5.9 SRC_HUMAN
81 PsiBlast_CBE 67.1856%-117 - C1 -1A1A 4.6 SRC_HUMAN
110 PsiBlast_CBE 67.0055%-139 - C1 -1HCS 3.3
114 PsiBlast_CBE 66.8555%-121 - C1 -1A1C 6.4 SRC_HUMAN
80 PsiBlast_CBE 66.7856%-109 - C1 -1A1A 6.2
111 PsiBlast_CBE 66.6755%-119 - C1 -1A1E 6.5
76 PsiBlast_CBE 65.9957%-135 - C1 -1SKJ 6.4
56 PsiBlast_CBE 65.9666% -94 - C1 -1AOU 4.8
68 PsiBlast_CBE 65.9057%-119 - C1 -1SPS 4.8 SRC_RSVSA
57 PsiBlast_CBE 65.2866% -90 - C1 -1AOT 2.0
270 PsiBlast_CBE 59.7933%-163 - C1 -1CSZ Error
282 HHSearch 56.6932% -91 - C1 -3PQZ 2.4 GRB7_HUMAN
58 PsiBlast_CBE 49.8166% -44 - C1 -4U17 2.1 ?
275 HHSearch 49.5735% -48 - C1 -1JU5 3.9 CRK_HUMAN
60 PsiBlast_CBE 48.7466% -43 - C1 -4U17 2.3 FYN_HUMAN