@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q53TG4_HUMAN: (2017-06-03 )
WYYGNVTRHQAECALNERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHY

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




CHAIN_L_3(2CI9)
NCK1_HUMAN
[Raw transfer]

-

CHAIN_L_2(2CIA)

[Raw transfer]

-

CHAIN_L_2(2CIA)

[Raw transfer]

-

CHAIN_M_4(2CI9)

[Raw transfer]

-

CHAIN_B_2(3WA4)
GRB2_HUMAN
[Raw transfer]

-

CHAIN_E_5(1R1P)
GRAP2_MOUSE
[Raw transfer]

-

CHAIN_B_2(3OV1)
GRB2_HUMAN
[Raw transfer]

-

259 HHSearch 91.15100%-111 - C2 -2CIA 7.9
2 PsiBlast_PDB 91.15100%-111 - C2 -2CIA 7.9
21 PsiBlast_CBE 85.5685% -94 - C2 -2CI9 7.7
4 PsiBlast_PDB 84.8685% -99 - C2 -2CI9 7.6 NCK1_HUMAN
1 PsiBlast_PDB 76.42100% -74 - C2 -1Z3K Calc...
123 PsiBlast_CBE 73.0833%-155 - C2 -4K45 - PLCG1_RAT -
33 PsiBlast_CBE 68.8940% -82 - C2 -4GWF - PTN11_HUMAN -
7 PsiBlast_PDB 68.4440% -62 - C2 -1AYB - PTN11_MOUSE -
8 PsiBlast_PDB 68.4040% -58 - C2 -1AYC - PTN11_MOUSE -
72 PsiBlast_CBE 67.6740% -53 - C2 -3IMD - GRB2_HUMAN -
28 PsiBlast_CBE 67.6440% -61 - C2 -4H34 - PTN11_HUMAN -
115 PsiBlast_CBE 67.5636% -97 - C2 -1R1Q - GRAP2_MOUSE -
29 PsiBlast_CBE 67.1240% -62 - C2 -5I6V - PTN11_HUMAN -
13 PsiBlast_PDB 67.0940% -53 - C2 -5DF6 - -
52 PsiBlast_CBE 67.0140% -58 - C2 -2HUW - GRB2_HUMAN -
9 PsiBlast_PDB 66.8840% -55 - C2 -1AYD - PTN11_MOUSE -
60 PsiBlast_CBE 66.8540% -57 - C2 -3S8O - GRB2_HUMAN -
62 PsiBlast_CBE 66.7840% -62 - C2 -3S8L - GRB2_HUMAN -
51 PsiBlast_CBE 66.4840% -58 - C2 -3C7I - GRB2_HUMAN -
11 PsiBlast_PDB 66.4340% -59 - C2 -3TL0 - PTN11_HUMAN -
260 HHSearch 65.8139% -73 - C2 -3WA4 7.3 GRB2_HUMAN
273 HHSearch 63.5039% -75 * C2 *3OV1 7.0 GRB2_HUMAN
275 HHSearch 59.8038% -88 - C2 -1R1P 6.5 GRAP2_MOUSE
278 Fugue 45.1139% 43 - C2 -1LKK Error LCK_HUMAN