@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q96EV4_HUMAN: (2017-06-03 )
REKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHY

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_B_2(2IUH)
KIT_HUMAN
[Raw transfer]

-

CHAIN_C_3(2IUI)
P85A_HUMAN
[Raw transfer]

-

CHAIN_D_4(2IUI)

[Raw transfer]

-

CHAIN_B_2(1FU5)

[Raw transfer]

-

3 PsiBlast_PDB 92.4184%-130 - C5 -2IUH 8.1 KIT_HUMAN
4 PsiBlast_PDB 90.7184%-127 - C5 -2IUI 5.8 P85A_HUMAN
15 PsiBlast_PDB 90.3884%-115 - C5 -4L23 Calc...
11 PsiBlast_PDB 90.3684%-149 - C5 -3HIZ Calc... P85A_HUMAN
2 PsiBlast_PDB 90.3284%-120 - C5 -2IUG Calc...
21 PsiBlast_CBE 90.2384%-123 - C5 -2IUI 6.1
14 PsiBlast_PDB 90.2284%-118 - C5 -4L1B Calc...
16 PsiBlast_PDB 90.0684%-122 - C5 -4L2Y Calc...
10 PsiBlast_PDB 89.8884%-134 - C5 -3HHM Calc...
40 HHSearch 88.4884%-120 - C5 -2IUG - -
50 HHSearch 88.0584%-134 - C5 -3HHM - -
6 PsiBlast_PDB 86.8784%-148 - C5 -5FI4 Calc...
45 HHSearch 86.4984% -82 - C5 -4L23 - -
12 PsiBlast_PDB 82.7884% - - C5 -4OVU Calc... P85A_HUMAN
5 PsiBlast_PDB 82.5384%-175 - C5 -4WAF Calc...
17 PsiBlast_PDB 81.2184% 0 - C- -4ZOP - -
9 PsiBlast_PDB 79.2184% -69 - C5 -2PNB Calc...
8 PsiBlast_PDB 78.0784% -82 - C5 -2PNA Calc...
7 PsiBlast_PDB 77.3984%-150 - C5 -5ITD Calc...
47 HHSearch 75.4737%-198 * C5 *3US4 Calc...
18 PsiBlast_PDB 61.5282% -34 - C5 -1FU5 0.2