@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VLZ7: (2017-11-05 )
MALTNEEILNAVAEKTVLELVELISAFEEKFNVSAAAVAVAAPAGGAAAAAEEQSEFNVELTSFGANKVAVIKAVREATGLGLKEAKDLVEGAPQVLKEGVSKEEGEELKKKLEEAGATVTLK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TBR_A_5(1DD4)
?
[Raw transfer]




TBR_A_6(1DD4)
?
[Raw transfer]




6 PsiBlast_PDB 74.7160% 43 - C5 -1DD3 - RL7_THEMA -
43 HHSearch 74.3363% 61 * C5 *1DD3 - RL7_THEMA -
23 Fugue 74.2960% 44 - C5 -1DD3 - RL7_THEMA -
21 PsiBlast_CBE 73.3260% 24 - C5 -1DD4 Calc... ?
7 PsiBlast_PDB 73.2460% 37 - C5 -1DD4 - ? -
2 PsiBlast_PDB 69.8363% -76 - C5 -1RQV - RL7_ECOLI -
1 PsiBlast_PDB 66.4663% -83 - C5 -1RQU - RL7_ECOLI -
4 PsiBlast_PDB 63.8774%-124 - C5 -1CTF - RL7_ECOLI -
3 PsiBlast_PDB 63.7474% -95 - C5 -1RQS - RL7_ECOLI -
40 HHSearch 60.8364% 36 - C5 -1RQU - RL7_ECOLI -
46 HHSearch 54.7374% 36 - C5 -1CTF - RL7_ECOLI -
5 PsiBlast_PDB 54.0475% - - C5 -2BCW - RL7_ECOLI -
47 HHSearch 53.8074% 49 - C5 -1RQS - RL7_ECOLI -
49 HHSearch 53.7075% - - C5 -2BCW - RL7_ECOLI -
8 PsiBlast_PDB 53.5628% - - C5 -2FTC - RM12_BOVIN -
38 HHSearch 49.1330% - - C5 -2FTC - RM12_BOVIN -
16 PsiBlast_PDB 41.8047%-170 - C1 -5I6H - ? -
17 PsiBlast_PDB 41.6347%-170 - C2 -5I6I - ? -
14 PsiBlast_PDB 41.3547%-170 - C3 -5I6G - ? -
63 HHSearch 39.9031%-165 - C5 -4PC3 - EFTS_ECOLI -