@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3TYC6: (2017-12-14 )
MDKPIRPEKEELKEKLSPMAYAVTQENATERPFSGKYDDFYEKGIYVDIVSGEPLFSSAEKYDAGCGWPSFSKPITKRQVREKADFSHGMHRIEVRSKEADSHLGHVFTDGPVDQGGLRYCINSASLKFIPYEKMDELGYGEFKSLVE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_B_8(3HCH)

[Raw transfer]




P6G_A_6(3HCH)
MSRAB_NEIMA
[Raw transfer]




25 HHSearch 86.9863% -43 - C4 -3HCG - MSRAB_NEIMA -
36 HHSearch 86.8059% -57 - C4 -5FA9 - ? -
1 PsiBlast_PDB 86.3462% -49 - C4 -3HCG - MSRAB_NEIMA -
26 HHSearch 86.0462% -37 - C4 -3HCH 3.1 MSRAB_NEIMA
19 PsiBlast_CBE 86.0259% -62 - C4 -5FA9 - ? -
18 PsiBlast_CBE 85.8562% -38 - C4 -3HCH 3.2
4 PsiBlast_PDB 85.8059% -61 - C4 -5FA9 - ? -
2 PsiBlast_PDB 85.7362% -38 - C4 -3HCH - MSRAB_NEIMA -
3 PsiBlast_PDB 85.5961% -56 - C4 -1L1D - MSRAB_NEIGO -
35 HHSearch 85.4155% -56 - C4 -3E0M - MSAB1_STRPN -
50 Fugue 83.4459% 3 - C4 -1L1D - MSRAB_NEIGO -
7 PsiBlast_PDB 82.2959% -45 - C4 -3E0O - MSRB_BACSU -
5 PsiBlast_PDB 81.2055% 75 - C4 -3E0M - MSAB1_STRPN -
30 HHSearch 80.8852% -57 - C4 -3CXK - MSRB_BURP1 -
27 HHSearch 80.1558% -45 - C4 -3E0O - MSRB_BACSU -
24 PsiBlast_CBE 79.3053% -60 - C4 -3CEZ - MSRB_BURP1 -
9 PsiBlast_PDB 79.0153% -64 - C4 -3CXK - MSRB_BURP1 -
8 PsiBlast_PDB 78.9253% -65 - C4 -3CEZ - MSRB_BURP1 -
6 PsiBlast_PDB 74.6759% -13 - C4 -2KZN - MSRB_BACSU -
13 PsiBlast_PDB 72.4041% -53 - C4 -3HCI - ? -