@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : bsu12960: (2016-06-20 )
MKRVKKLWGMGLALGLSFALMGCTANEQAGKEGSHDKAKTSGEKVLYVNNENEPTSFDPPIGFNNVSWQPLNNIMEGLTRLGKDHEPEPAMAEKWSVSKDNKTYTFTIRENAKWTNGDPVTAGDFEYAWKRMLDPKKGASSAFLGYFIEGGEAYNSGKGKKDDVKVTAKDDRTLEVTLEAPQKYFLSVVSNPAYFPVNEKVDKDNPKWFAESDTFVGNGPFKLTEWKHDDSITMEKSDTYWDKDTVKLDKVKWAMVSDRNTDYQMFQSGELDTAYVPAELSDQLLDQDNVNIVDQAGLYFYRFNVNMEPFQNENIRKAFAMAVDQEEIVKYVTKNNEKPAHAFVSPGFTQPDGKDFREAGGDLIKPNESKAKQLLEKGMKEENYNKLPAITLTYSTKPEHKKIAEAIQQKLKNSLGVDVKLANMEWNVFLEDQKALKFQFSQSSFLPDYADPISFLEAFQTGNSMNRTGWANKEYDQLIKQAKNEADEKTRFSLMHQAEELLINEAPIIPVYFYNQVHLQNEQVKGIVRHPVGYIDLKWADKN

Atome Classification :

(20 SA) .........10........20........30........40........50........60---.........70...----.....80........90..-.-.....100.......110.......120.......130.......140-....-.--..150.......160.......170.......180.......190.....-.-.200..-.....210.-......220.....---..230.......240.......250.......260.......270-..--.--....280.....--..290..--.....300....--..--.310.......320.......330.......340.---...-----.-------..350.......360....----------...370.....-..380.......390.......400.......410..-.-....420.......430.......440.......450.......460.......470.......480.......490.......500.......510.......520.......530..-....--.540.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKRVKKLWGMGLALGLSFALMGCTANEQAGKEGSHDKAKTSGEKVLYVNNENEPTSFDPP----IGFNNVSWQPLNNI----MEGLTRLGKDHEPEPAMAE-K-WSVSKDNKTYTFTIRENAKWTNGDPVTAGDFEYAWKRMLDPKKGASSA-FLGY-F--IEGGEAYNSGKGKKDDVKVTAKDDRTLEVTLEAPQKYFLSVVSNPAYFPV-N-EKVDKD-NPKWFAESD-TFVGNGPFKLTEWK---HDDSITMEKSDTYWDKDTVKLDKVKWAMVSDRNTDYQMFQSGELD-TA--Y--VPAELSDQLLDQ--DNVNIVD--QAGLYFYRFNVN--ME--PFQNENIRKAFAMAVDQEEIVKYVTKNNEKPAHAF---VSP-----G-------FTQPDGKDFREAGGDLIKP----------NESKAKQLLEK-GMKEENYNKLPAITLTYSTKPEHKKIAEAIQQKLKNS-L-GVDVKLANMEWNVFLEDQKALKFQFSQSSFLPDYADPISFLEAFQTGNSMNRTGWANKEYDQLIKQAKNEADEKTRFSLMHQAEELLINEAPIIPVYFYNQVHLQNEQVKGIVRHPVGY-IDLK--WADKN
1 PsiBlast_PDB 87.2532% -47 - C3 -4FAJ ? A:[58-552] -----------------------------------------VEQVATLTAGTPVQSLDPA----TAVDQTSITLLANV----MEGLYRLDEKNQPQPAIAAGQ-PKVSNNGKTYTIVIRDGAKWSDGTQITASDFVAAWQRVVDPKTVSPNV-ELFS-A--IKNAKEIASGKQAKDTLAVKSIGEKTLEIELVEPTPYFTDLLSLTAYYPV-Q-QKAIKE-YGKDYGVSQKAIVTNGAFNLTNLEGVGTSDKWTISKNKEYWDQKDVSMDKINFQVVKEINTGINLYNDGQLD-EA--P--LAGEYAKQYKKD--KEYSTTL--MANTMFLEMNQT--GENKLLQNKNVRKAINYAIDRESLVKKLLDNGSVASVGV---VPKEM---A-------FNPVNKKDF--ANEKLVEF----------NKKQAEEYWDK-AKKEIDLSKNTSLDLLVSDGEFEKKAGEFLQGQLQDS-LEGLKVTVTPIPANVFMERLTKKDFTLSLSGWQADYADPISFLANFETNSPMNHGGYSNKNYDELLKDSSSK-----RWQELKKAEKLLINDMGVVPIFQVGTAKLEKSKIKNVLMHSIG-------------
54 PsiBlast_CBE 84.2831% -58 - C3 -3ZS6 ? A:[34-497] ----------------------------------------------------------------------------DL----FEGLARIDASGAVVPGVAQ-A-WE-HKAPDTWIFKLRRDAKWSNGQPVTAADFVYAWQRLADPKTGSKYT-ILVE-F--VKNASAIIAGKQPPGDLGIRAIDPYTIEVKTEVPVSYFPELTAMAPLTPV-NKDAVAKF-GDAW-TRPK-NIVSNGPYTLVDWQ---PNNRIVMAKSDKYWNARNVVIRKVTYLPIENDETALRMYQAGQID-YT--YS-IPAGGFGQISKQ--FGKELRPGLQLATYYYYLKNS--DP--ALKDKRVREALAMVLDREILTSKITQAGEVPMYGL---MPK-----GVKGVQRPFT-PDWASWPMAR----------------RVDYAKNLLKQ-A-GHGDANPL-TFTLTYNTNDLHKKVALFAASEWRTK-L-GVTAKLENVEFKVLMKQRHDGKVQIARDGWFADYNDAMTFFDLIRCGSSQNTVGYCNPKVDSLVAEANQKLDDGARAALLTQAHDLAMNDYPMVPLFQYSADRLVKSYVGGYTL--TNY-IDMR-------
55 HHSearch 84.2731% -43 - C3 -4FAJ ? A:[58-564] -----------------------------------------VEQVATLTAGTPVQSLDPA----TAVDQTSITLLANV----MEGLYRLDEKNQPQPAIAA-GQPKVSNNGKTYTIVIRDGAKWSDGTQITASDFVAAWQRVVDPKTVSPNV-ELFS-A--IKNAKEIASGKQAKDTLAVKSIGEKTLEIELVEPTPYFTDLLSLTAYYPV-Q-QKAIKEYGKDYGVSQK-AIVTNGAFNLTNLEGVGTSDKWTISKNKEYWDQKDVSMDKINFQVVKEINTGINLYNDGQLD-EA--P--LAGEYAKQYKKD--KEYSTTL--MANTMFLEMNQTGENK--LLQNKNVRKAINYAIDRESLVKKLLDNGSVASVGV---VPK-----E-------MAFNPVNKKDFANEKLVEF----------NKKQAEEYWDKAKKEIDL-SKNTSLDLLVSDGEFEKKAGEFLQGQLQDSLE-GLKVTVTPIPANVFMERLTKKDFTLSLSGWQADYADPISFLANFETNSPMNHGGYSNKNYDELLKDS-----SSKRWQELKKAEKLLINDMGVVPIFQVGTAKLEKSKIKNVLMHSIGAKYDYKKMRIEK-
18 PsiBlast_PDB 83.9132% -43 - C3 -1B3L OPPA_SALTY A:[7-497] -------------------------------------VQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVS----RDL----FEGLLISDVEGHPSPGVAE-K-WE-NKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGH--IANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPK-SAVEKF-GDKW-TQPA-NIVTNGAYKLKNWV---VNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEID-MT--YNNMPIELFQKLKKEIPNEVRVDP--YLCTYYYEINNQ--KA--PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSY----TP-----P-------YTD---------GAKLVEPEWFKWSQQKRNEEAKKLLAEA-GFTAD---KPLTFDLLYNTSDLHKKLAIAVASIWKKN-L-GVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--------------------
3 PsiBlast_PDB 83.8132% -49 - C3 -3O9P MPPA_ECOLI A:[24-499] --------------------------------------------------KDEPASLDPA----KAVGLPEIQVIRDL----FEGLVNQNEKGEIVPGVAT-Q-WK-SNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFA-WFAA-LAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPV---QKANVE-SGKEWTKPG-NLIGNGAYVLKERV---VNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITE--S--FPKNMYQKLLKDIPGQVYTPP--QLGTYYYAFNTQ--KG--PTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTA-----G-------FT-PEPSPFEQMSQEEL-------------NAQAKTLLSAAGYGPQKPLKL---TLLYNTSENHQKIAIAVASMWKKN-L-GVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKG--------------------
7 PsiBlast_PDB 83.7832% -52 - C- -3TCH - OPPA_ECOLI A:[38-523] ------------------------------------------KQTLVRNNGSEVQSLDP--------HKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAE-S-WD-NKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGH--IAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPK-AAIEKF-GEKW-TQPG-NIVTNGAYTLKDWV---VNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEID-MTNNS--MPIELFQKLKKEIPDEVHVDP--YLCTYYYEINNQ--KP--PFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGY---TPPYTDGAK-------LTQPEWFGWSQE-----KR----------NEEAKKLLAEA-GYTAD---KPLTINLLYNTSDLHKKLAIAASSLWKKN-I-GVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--------------------
36 PsiBlast_CBE 83.0032% -41 - C3 -1QKA OPPA_SALTY A:[7-497] -------------------------------------VQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVS----RDL----FEGLLISDVEGHPSPGVAE-K-WE-NKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGH--IANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPK-SAVEKF-GDKW-TQPA-NIVTNGAYKLKNWV---VNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEID-MT--YNNMPIELFQKLKKEIPNEVRVDP--YLCTYYYEINNQ--KA--PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSY----TP-----P-------YTD---------GAKLVEPEWFKWSQQKRNEEAKKLLAEA-GFTAD---KPLTFDLLYNTSDLHKKLAIAVASIWKKN-L-GVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--------------------
14 PsiBlast_PDB 82.8632% -41 - C3 -2RKM OPPA_SALTY A:[7-497] -------------------------------------VQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVS----RDL----FEGLLISDVEGHPSPGVAE-K-WE-NKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGH--IANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPK-SAVEKF-GDKW-TQPA-NIVTNGAYKLKNWV---VNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEID-MT--YNNMPIELFQKLKKEIPNEVRVDP--YLCTYYYEINNQ--KA--PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSY----TP-----P-------YTD---------GAKLVEPEWFKWSQQKRNEEAKKLLAEA-GFTAD---KPLTFDLLYNTSDLHKKLAIAVASIWKKN-L-GVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--------------------
41 PsiBlast_CBE 82.5932% -40 - C3 -1B5H OPPA_SALTY A:[7-497] -------------------------------------VQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVS----RDL----FEGLLISDVEGHPSPGVAE-K-WE-NKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGH--IANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPK-SAVEKF-GDKW-TQPA-NIVTNGAYKLKNWV---VNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEID-MT--YNNMPIELFQKLKKEIPNEVRVDP--YLCTYYYEINNQ--KA--PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSY----TP-----P-------YTD---------GAKLVEPEWFKWSQQKRNEEAKKLLAEA-GFTAD---KPLTFDLLYNTSDLHKKLAIAVASIWKKN-L-GVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--------------------
4 PsiBlast_PDB 82.5832% -55 - C3 -4TOZ MPPA_ECOLI A:[20-495] --------------------------------------------------KDEPASLDPA----KAVGLPEIQVIRDL----FEGLVNQNEKGEIVPGVAT-Q-WK-SNDNRIWTFTLRDNAKWADGTPVTAQDFVYSWQRLVDPKTLSPFA-WFAA-LAGINNAQAIIDGKATPDQLGVTAVDAHTLKIQLDKPLPWFVNLTANFAFFPV---QKANVE-SGKEWTKPG-NLIGNGAYVLKERV---VNEKLVVVPNTHYWDNAKTVLQKVTFLPINQESAATKRYLAGDIDITE--S--FPKNMYQKLLKDIPGQVYTPP--QLGTYYYAFNTQ--KG--PTADQRVRLALSMTIDRRLMTEKVLGTGEKPAWHFTPDVTA-----G-------FT-PEPSPFEQMSQEDL-------------NAQAKTLLSAAGYGPQKPLKL---TLLYNTSENHQKIAIAVASMWKKN-L-GVDVKLQNQEWKTYIDSRNTGNFDVIRASWVGDYNEPSTFLTLLTSTHSGNISRFNNPAYDKVLAQASTENTVKARNADYNAAEKILMEQAPIAPIYQYTNGRLIKPWLKG--------------------
40 PsiBlast_CBE 82.5332% -42 - C3 -1B5I OPPA_SALTY A:[7-497] -------------------------------------VQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVS----RDL----FEGLLISDVEGHPSPGVAE-K-WE-NKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGH--IANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPK-SAVEKF-GDKW-TQPA-NIVTNGAYKLKNWV---VNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEID-MT--YNNMPIELFQKLKKEIPNEVRVDP--YLCTYYYEINNQ--KA--PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSY----TP-----P-------YTD---------GAKLVEPEWFKWSQQKRNEEAKKLLAEA-GFTAD---KPLTFDLLYNTSDLHKKLAIAVASIWKKN-L-GVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--------------------
51 PsiBlast_CBE 82.5032% -41 - C3 -1B2H OPPA_SALTY A:[7-497] -------------------------------------VQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVS----RDL----FEGLLISDVEGHPSPGVAE-K-WE-NKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGH--IANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPK-SAVEKF-GDKW-TQPA-NIVTNGAYKLKNWV---VNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEID-MT--YNNMPIELFQKLKKEIPNEVRVDP--YLCTYYYEINNQ--KA--PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSY----TP-----P-------YTD---------GAKLVEPEWFKWSQQKRNEEAKKLLAEA-GFTAD---KPLTFDLLYNTSDLHKKLAIAVASIWKKN-L-GVNVNLENQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSDSSNNTAHYKSPAFDKLIADTLKVADDTQRSELYAKAEQQLDKDSAIVPVYYYVNARLVKPWVGG--------------------
52 PsiBlast_CBE 82.4632% -41 - C3 -1B1H OPPA_SALTY A:[7-497] -------------------------------------VQLADKQTLVRNNGSEVQSLDPHKIEGVPESNVS----RDL----FEGLLISDVEGHPSPGVAE-K-WE-NKDFKVWTFHLRENAKWSDGTPVTAHDFVYSWQRLADPNTASPYASYLQYGH--IANIDDIIAGKKPATDLGVKALDDHTFEVTLSEPVPYFYKLLVHPSVSPVPK-SAVEKF-GDKW-TQPA-NIVTNGAYKLKNWV---VNERIVLERNPQYWDNAKTVINQVTYLPISSEVTDVNRYRSGEID-MT--YNNMPIELFQKLKKEIPNEVRVDP--YLCTYYYEINNQ--KA--PFNDVRVRTALKLALDRDIIVNKVKNQGDLPAYSY----