@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF00303_TYSY_E: (2014-09-04 )
MKQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI

Atome Classification :

(60 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PFG_A_4(2BBQ)
TYSY_ECOLI
[Raw transfer]




D16_F_6(2KCE)
TYSY_ECOLI
[Raw transfer]




D16_D_4(2KCE)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(2TSC)
TYSY_ECOLI
[Raw transfer]




C2F_G_7(1TSN)
TYSY_ECOLI
[Raw transfer]




PFG_B_6(2BBQ)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(2TSC)
TYSY_ECOLI
[Raw transfer]




CB3_A_4(1KCE)
TYSY_ECOLI
[Raw transfer]




F89_A_4(1TLC)
TYSY_ECOLI
[Raw transfer]




UMP_C_3(2KCE)
TYSY_ECOLI
[Raw transfer]




CB3_B_7(4KNZ)
TYSY_ECOLI
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




CB3_B_6(1KCE)
TYSY_ECOLI
[Raw transfer]




CB3_E_5(1TRG)
TYSY_ECOLI
[Raw transfer]




D16_A_7(3NRR)
?
[Raw transfer]




CB3_A_6(1TDU)
TYSY_ECOLI
[Raw transfer]




C2F_B_6(1TLS)
TYSY_ECOLI
[Raw transfer]




THG_A_4(3BHL)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(2BBQ)
TYSY_ECOLI
[Raw transfer]




CB3_A_6(1DDU)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(2TSC)
TYSY_ECOLI
[Raw transfer]




NDU_A_3(3B5B)
TYSY_ECOLI
[Raw transfer]




F89_B_6(1TLC)
TYSY_ECOLI
[Raw transfer]




F89_I_9(1F28)
TYSY_PNECA
[Raw transfer]




F89_A_6(1TSD)
TYSY_ECOLI
[Raw transfer]




UMP_A_6(3NRR)
?
[Raw transfer]




THG_G_7(1KZI)
TYSY_ECOLI
[Raw transfer]




C2F_A_4(1TLS)
TYSY_ECOLI
[Raw transfer]




F89_E_4(1SYN)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(4FQS)
TYSY_MYCTU
[Raw transfer]




NOH_A_2(4EZ8)
TYSY_MOUSE
[Raw transfer]




F89_F_6(1SYN)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(2VET)
TYSY_ECOLI
[Raw transfer]




F89_B_8(1TSD)
TYSY_ECOLI
[Raw transfer]




CB3_B_8(1TDU)
TYSY_ECOLI
[Raw transfer]




CB3_B_8(1DDU)
TYSY_ECOLI
[Raw transfer]




LYB_F_6(1JTU)
TYSY_ECOLI
[Raw transfer]




LY3_D_4(1JTQ)
TYSY_ECOLI
[Raw transfer]




THG_J_10(1KZI)
TYSY_ECOLI
[Raw transfer]




UMP_E_5(1F28)
TYSY_PNECA
[Raw transfer]




UMP_A_3(4DQ1)
TYSY_STAAM
[Raw transfer]




UMP_A_5(4G9U)
?
[Raw transfer]




LYD_D_4(1JUT)
TYSY_ECOLI
[Raw transfer]




UMP_C_7(1J3K)
?
[Raw transfer]




NDN_B_4(3B5B)
TYSY_ECOLI
[Raw transfer]




LYA_A_4(4FQS)
TYSY_MYCTU
[Raw transfer]




LY3_F_6(1JTQ)
TYSY_ECOLI
[Raw transfer]




CB3_B_6(1AN5)
TYSY_ECOLI
[Raw transfer]




GOL_D_(2A9W)
TYSY_ECOLI
[Raw transfer]




UMP_A_5(3QG2)
?
[Raw transfer]




GOL_D_(2A9W)
TYSY_ECOLI
[Raw transfer]




LYB_D_4(1JTU)
TYSY_ECOLI
[Raw transfer]




MTX_A_4(1AXW)
TYSY_ECOLI
[Raw transfer]




UMP_A_6(1KZI)
TYSY_ECOLI
[Raw transfer]




DUR_A_5(1TDU)
TYSY_ECOLI
[Raw transfer]




TP3_A_8(1F4F)
TYSY_ECOLI
[Raw transfer]




NDU_A_5(3BHR)
TYSY_ECOLI
[Raw transfer]




CB3_A_5(1AN5)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(1JTU)
TYSY_ECOLI
[Raw transfer]




NDU_A_3(3BHL)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(1JUT)
TYSY_ECOLI
[Raw transfer]




UMP_C_3(1SYN)
TYSY_ECOLI
[Raw transfer]




MTX_B_6(1AXW)
TYSY_ECOLI
[Raw transfer]




DDU_B_7(1DDU)
TYSY_ECOLI
[Raw transfer]




DDU_A_5(1DDU)
TYSY_ECOLI
[Raw transfer]




UFP_A_3(1TLS)
TYSY_ECOLI
[Raw transfer]




DUR_B_7(1TDU)
TYSY_ECOLI
[Raw transfer]




UFP_E_5(1TSN)
TYSY_ECOLI
[Raw transfer]




UMP_C_3(1TRG)
TYSY_ECOLI
[Raw transfer]




THG_A_3(3BHR)
TYSY_ECOLI
[Raw transfer]




DGP_A_3(1TLC)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(1JTQ)
TYSY_ECOLI
[Raw transfer]




DDU_E_5(1AOB)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(1KCE)
TYSY_ECOLI
[Raw transfer]




NDU_A_4(3B9H)
TYSY_ECOLI
[Raw transfer]




DUR_E_5(1BDU)
TYSY_ECOLI
[Raw transfer]




TP3_B_9(1F4F)
TYSY_ECOLI
[Raw transfer]




THG_B_8(3BHL)
TYSY_ECOLI
[Raw transfer]




LYD_F_6(1JUT)
TYSY_ECOLI
[Raw transfer]




UMP_C_3(1BID)
TYSY_ECOLI
[Raw transfer]




CIT_A_5(3V8H)
?
[Raw transfer]




GA9_C_25(2A9W)
TYSY_ECOLI
[Raw transfer]




GA9_A_18(2A9W)
TYSY_ECOLI
[Raw transfer]




DTT_A_6(4G9U)
?
[Raw transfer]




GA9_B_22(2A9W)
TYSY_ECOLI
[Raw transfer]




UMP_A_3(1AXW)
TYSY_ECOLI
[Raw transfer]




UMP_A_5(1TSD)
TYSY_ECOLI
[Raw transfer]




BME_A_19(2A9W)
TYSY_ECOLI
[Raw transfer]




BME_A_3(1TSD)
TYSY_ECOLI
[Raw transfer]




BME_C_26(2A9W)
TYSY_ECOLI
[Raw transfer]




2BR_B_23(2A9W)
TYSY_ECOLI
[Raw transfer]




16 PsiBlast_PDB 97.6699%-137 - C7 -2VET 4.8 TYSY_ECOLI
13 PsiBlast_PDB 97.49100%-139 - C7 -2KCE 7.0 TYSY_ECOLI
22 PsiBlast_CBE 97.24100%-139 - C7 -2BBQ 7.2 TYSY_ECOLI
31 PsiBlast_CBE 97.2399%-140 - C7 -2TSC 7.5 TYSY_ECOLI
30 PsiBlast_CBE 97.0799%-135 - C7 -3B5B 5.8 TYSY_ECOLI
17 PsiBlast_PDB 97.0399%-135 - C7 -3B5B 4.9 TYSY_ECOLI
21 PsiBlast_CBE 97.01100%-137 - C7 -2KCE 6.4 TYSY_ECOLI
12 PsiBlast_PDB 96.80100%-134 - C7 -2BBQ 7.3 TYSY_ECOLI
18 PsiBlast_PDB 96.7899%-138 - C7 -2TSC 7.5 TYSY_ECOLI
77 HHSearch 86.9367%-132 * C7 *4FQS 5.5 TYSY_MYCTU
74 HHSearch 84.3660%-137 - C7 -4DQ1 4.8 TYSY_STAAM
78 HHSearch 83.5655%-127 - C7 -4EZ8 4.7 TYSY_MOUSE
93 HHSearch 83.2248%-132 - C7 -3QG2 4.7 ?
84 HHSearch 82.5348%-129 - C7 -1J3K 5.4 ?
80 HHSearch 81.8252%-135 - C7 -4G9U 5.4 ?
88 HHSearch 81.1448%-130 - C7 -3NRR 6.1 ?
81 HHSearch 80.1749%-123 - C7 -1F28 6.6 TYSY_PNECA
85 HHSearch 75.6641%-120 - C7 -3V8H 2.3 ?
29 PsiBlast_CBE 66.23100% -27 - C7 -1AN5 4.3 TYSY_ECOLI
11 PsiBlast_PDB 66.17100% -27 - C7 -1SYN 5.7 TYSY_ECOLI
24 PsiBlast_CBE 66.12100% -31 - C7 -1TLC 3.8 TYSY_ECOLI
8 PsiBlast_PDB 65.94100% -30 - C7 -1BID 2.0 TYSY_ECOLI
43 PsiBlast_CBE 65.88100% -23 - C7 -3BHL 4.0 TYSY_ECOLI
7 PsiBlast_PDB 65.79100% -26 - C7 -1BDU 2.4 TYSY_ECOLI
59 PsiBlast_CBE 65.77100% -30 - C7 -1JTQ 7.1 TYSY_ECOLI
19 PsiBlast_PDB 65.67100% -25 - C7 -1KCE 4.2 TYSY_ECOLI
53 PsiBlast_CBE 65.65100% -29 - C7 -1KZI 3.0 TYSY_ECOLI
23 PsiBlast_CBE 65.60100% -25 - C7 -1TSD 4.9 TYSY_ECOLI
15 PsiBlast_PDB 65.59100% -26 - C7 -1AOB 3.2 TYSY_ECOLI
26 PsiBlast_CBE 65.53100% -28 - C7 -1SYN 5.4 TYSY_ECOLI
2 PsiBlast_PDB 65.39100% -27 - C7 -1TSD 5.6 TYSY_ECOLI
46 PsiBlast_CBE 65.36100% -26 - C7 -2A9W 1.8 TYSY_ECOLI
47 PsiBlast_CBE 65.32100% -27 - C7 -2A9W 5.7 TYSY_ECOLI
5 PsiBlast_PDB 65.30100% -27 - C7 -1AN5 5.0 TYSY_ECOLI
1 PsiBlast_PDB 65.30100% -24 - C7 -1TLC 5.6 TYSY_ECOLI
54 PsiBlast_CBE 65.29100% -28 - C7 -1KCE 4.1 TYSY_ECOLI
4 PsiBlast_PDB 65.15100% -33 - C7 -1TDU 4.9 TYSY_ECOLI
25 PsiBlast_CBE 65.14100% -31 - C7 -1TDU 2.7 TYSY_ECOLI
48 PsiBlast_CBE 65.07100% -26 - C7 -2A9W 5.8 TYSY_ECOLI
51 PsiBlast_CBE 65.06100% -27 - C7 -1TLS 3.7 TYSY_ECOLI
42 PsiBlast_CBE 65.05100% -26 - C7 -3BHL 5.1 TYSY_ECOLI
33 PsiBlast_CBE 65.04100% -24 - C7 -4KNZ 3.9 TYSY_ECOLI
6 PsiBlast_PDB 65.03100% -29 - C7 -1AXW 4.2 TYSY_ECOLI
57 PsiBlast_CBE 65.00100% -26 - C7 -1JTU 3.5 TYSY_ECOLI
20 PsiBlast_PDB 64.99100% -21 - C7 -1TLS 2.7 TYSY_ECOLI
62 PsiBlast_CBE 64.96100% -26 - C7 -1F4F 1.2 TYSY_ECOLI
28 PsiBlast_CBE 64.88100% -31 - C7 -1AXW 3.8 TYSY_ECOLI
49 PsiBlast_CBE 64.80100% -27 - C7 -2A9W 4.6 TYSY_ECOLI
60 PsiBlast_CBE 64.73100% -24 - C7 -1JTQ 4.0 TYSY_ECOLI
52 PsiBlast_CBE 64.72100% -26 - C7 -1KZI 3.8 TYSY_ECOLI
55 PsiBlast_CBE 64.68100% -25 - C7 -1JUT 4.5 TYSY_ECOLI
10 PsiBlast_PDB 64.57100% -30 - C7 -1TRG 3.9 TYSY_ECOLI
27 PsiBlast_CBE 64.49100% -24 - C7 -1DDU 2.8 TYSY_ECOLI
3 PsiBlast_PDB 64.48100% -25 - C7 -1DDU 3.7 TYSY_ECOLI
41 PsiBlast_CBE 64.39100% -25 - C7 -3BHR 4.5 TYSY_ECOLI
56 PsiBlast_CBE 64.37100% -25 - C7 -1JUT 4.4 TYSY_ECOLI
61 PsiBlast_CBE 64.32100% -26 - C7 -1F4F 2.8 TYSY_ECOLI
50 PsiBlast_CBE 64.32100% -22 - C7 -1TSN 4.5 TYSY_ECOLI
58 PsiBlast_CBE 64.10100% -28 - C7 -1JTU 4.8 TYSY_ECOLI
44 PsiBlast_CBE 63.88100% -24 - C7 -3B9H 1.4 TYSY_ECOLI