@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : CDK7_HUMAN: (2015-10-05 )
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Atome Classification :

(99 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_H_8(1UA2)
CDK7_HUMAN
[Raw transfer]




EZV_A_6(3F5X)
CDK2_HUMAN
[Raw transfer]




EZV_C_8(3F5X)
CDK2_HUMAN
[Raw transfer]




L0H_A_2(2W1H)
CDK2_HUMAN
[Raw transfer]




ANP_A_5(4IC7)
MK07_HUMAN
[Raw transfer]




LZ8_A_2(2VTO)
CDK2_HUMAN
[Raw transfer]




NS9_A_2(3NS9)
CDK2_HUMAN
[Raw transfer]




889_A_6(2WPA)
CDK2_HUMAN
[Raw transfer]




FRV_A_3(2W06)
CDK2_HUMAN
[Raw transfer]




LZ9_A_2(2VTP)
CDK2_HUMAN
[Raw transfer]




889_C_7(2WPA)
CDK2_HUMAN
[Raw transfer]




ATP_G_7(1UA2)
CDK7_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




5BP_C_6(3EJ1)
CDK2_HUMAN
[Raw transfer]




PDY_A_3(3WBL)
CDK2_HUMAN
[Raw transfer]




A27_A_2(3LFN)
CDK2_HUMAN
[Raw transfer]




FRT_A_2(2W05)
CDK2_HUMAN
[Raw transfer]




A07_A_2(3LFS)
CDK2_HUMAN
[Raw transfer]




P48_A_5(2WIH)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1UA2)
CDK7_HUMAN
[Raw transfer]




ANP_C_3(1J1B)
GSK3B_HUMAN
[Raw transfer]




1QK_A_3(4KD1)
CDK2_HUMAN
[Raw transfer]




1N3_A_2(3ULI)
CDK2_HUMAN
[Raw transfer]




X1N_A_6(2X1N)
CDK2_HUMAN
[Raw transfer]




3TI_A_2(3TIZ)
CDK2_HUMAN
[Raw transfer]




ATP_F_6(1UA2)
CDK7_HUMAN
[Raw transfer]




P48_C_6(2WIH)
CDK2_HUMAN
[Raw transfer]




SBC_C_8(2BKZ)
CDK2_HUMAN
[Raw transfer]




PO5_A_5(3EID)
CDK2_HUMAN
[Raw transfer]




B49_A_2(3TI1)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(2B9H)
FUS3_YEAST
[Raw transfer]




CDK_A_2(2XMY)
CDK2_HUMAN
[Raw transfer]




SBC_A_7(2BKZ)
CDK2_HUMAN
[Raw transfer]




5BP_A_5(3EJ1)
CDK2_HUMAN
[Raw transfer]




HDT_A_2(1OIT)
CDK2_HUMAN
[Raw transfer]




CK7_A_7(2WEV)
CDK2_HUMAN
[Raw transfer]




LIG_B_2(1JVP)
CDK2_HUMAN
[Raw transfer]




LZE_A_2(2VU3)
CDK2_HUMAN
[Raw transfer]




514_A_7(2C4G)
CDK2_HUMAN
[Raw transfer]




LZA_A_2(2VTQ)
CDK2_HUMAN
[Raw transfer]




Y8L_A_2(2XNB)
CDK2_HUMAN
[Raw transfer]




WXV_C_6(2WXV)
CDK2_HUMAN
[Raw transfer]




LZC_A_2(2VTS)
CDK2_HUMAN
[Raw transfer]




292_C_8(1VYW)
CDK2_HUMAN
[Raw transfer]




107_E_5(1FVV)
CDK2_HUMAN
[Raw transfer]




529_A_7(2BPM)
CDK2_HUMAN
[Raw transfer]




60K_C_8(4FX3)
CDK2_HUMAN
[Raw transfer]




P49_C_6(2WIP)
CDK2_HUMAN
[Raw transfer]




P49_A_5(2WIP)
CDK2_HUMAN
[Raw transfer]




ADP_A_4(3NIZ)
?
[Raw transfer]




529_C_8(2BPM)
CDK2_HUMAN
[Raw transfer]




514_C_8(2C4G)
CDK2_HUMAN
[Raw transfer]




LZ3_A_2(2VTI)
CDK2_HUMAN
[Raw transfer]




1YG_A_2(4LYN)
CDK2_HUMAN
[Raw transfer]




0BX_A_2(3UNJ)
CDK2_HUMAN
[Raw transfer]




292_A_7(1VYW)
CDK2_HUMAN
[Raw transfer]




56H_A_2(5D1J)
?
[Raw transfer]




WXV_A_5(2WXV)
CDK2_HUMAN
[Raw transfer]




T2A_C_6(3EOC)
CDK2_HUMAN
[Raw transfer]




D6I_A_3(4BZD)
CDK2_HUMAN
[Raw transfer]




GOL_A_2(2VTJ)
CDK2_HUMAN
[Raw transfer]




LZ7_A_2(2VTN)
CDK2_HUMAN
[Raw transfer]




LZ5_A_2(2VTL)
CDK2_HUMAN
[Raw transfer]




LQ5_A_2(5A14)
?
[Raw transfer]




3I6_A_2(4BGH)
CDK2_HUMAN
[Raw transfer]




I17_B_2(1G5S)
CDK2_HUMAN
[Raw transfer]




A28_A_2(3LFQ)
CDK2_HUMAN
[Raw transfer]




T2A_A_5(3EOC)
CDK2_HUMAN
[Raw transfer]




B98_A_2(3FZ1)
CDK2_HUMAN
[Raw transfer]




60K_A_5(4FX3)
CDK2_HUMAN
[Raw transfer]




ESJ_A_2(4D1X)
CDK2_HUMAN
[Raw transfer]




DTQ_B_2(1DI8)
CDK2_HUMAN
[Raw transfer]




PMU_A_2(3S2P)
CDK2_HUMAN
[Raw transfer]




0BY_A_2(3UNK)
CDK2_HUMAN
[Raw transfer]




ATP_E_5(1FIN)
CDK2_HUMAN
[Raw transfer]




106_A_2(1FVT)
CDK2_HUMAN
[Raw transfer]




PVB_A_2(1CKP)
CDK2_HUMAN
[Raw transfer]




Z3R_A_6(4AU8)
CDK5_HUMAN
[Raw transfer]




LZ2_A_2(2VTH)
CDK2_HUMAN
[Raw transfer]




LZ4_A_3(2VTJ)
CDK2_HUMAN
[Raw transfer]




LZ6_A_2(2VTM)
CDK2_HUMAN
[Raw transfer]




LZB_A_2(2VTR)
CDK2_HUMAN
[Raw transfer]




0SR_A_3(4F6U)
CDK8_HUMAN
[Raw transfer]




TIY_A_14(3TIY)
CDK2_HUMAN
[Raw transfer]




19K_A_2(3SW7)
CDK2_HUMAN
[Raw transfer]




10K_A_2(4EK6)
CDK2_HUMAN
[Raw transfer]




EFP_A_2(3IG7)
CDK2_HUMAN
[Raw transfer]




11K_A_2(4FKJ)
CDK2_HUMAN
[Raw transfer]




I19_A_3(2W17)
CDK2_HUMAN
[Raw transfer]




EDO_A_3(1CKP)
CDK2_HUMAN
[Raw transfer]




42K_A_2(4FKQ)
CDK2_HUMAN
[Raw transfer]




61K_A_2(4FKV)
CDK2_HUMAN
[Raw transfer]




03K_A_2(4EK5)
CDK2_HUMAN
[Raw transfer]




EFQ_A_2(3IGG)
CDK2_HUMAN
[Raw transfer]




20K_A_2(4FKO)
CDK2_HUMAN
[Raw transfer]




IM9_A_2(2VV9)
CDK2_HUMAN
[Raw transfer]




4CK_A_2(4FKG)
CDK2_HUMAN
[Raw transfer]




1CK_A_2(4EK4)
CDK2_HUMAN
[Raw transfer]




EDO_A_13(3TIY)
CDK2_HUMAN
[Raw transfer]




62K_A_2(4FKW)
CDK2_HUMAN
[Raw transfer]




45K_A_2(4FKR)
CDK2_HUMAN
[Raw transfer]




EDO_A_10(3TIZ)
CDK2_HUMAN
[Raw transfer]




IMD_B_11(4AU8)
CDK5_HUMAN
[Raw transfer]




21 PsiBlast_CBE 92.7799%-125 - C1 -1UA2 5.1 CDK7_HUMAN
111 HHSearch 92.44100%-124 - C1 -1UA2 5.1 CDK7_HUMAN
1 PsiBlast_PDB 92.1999%-124 - C1 -1UA2 5.1 CDK7_HUMAN
22 PsiBlast_CBE 92.0499%-123 - C1 -1UA2 5.7 CDK7_HUMAN
23 PsiBlast_CBE 89.7599%-122 - C1 -1UA2 4.6 CDK7_HUMAN
70 PsiBlast_CBE 78.1644%-119 - C1 -3FZ1 3.7 CDK2_HUMAN
86 PsiBlast_CBE 78.1044%-120 - C1 -2W06 7.0 CDK2_HUMAN
90 PsiBlast_CBE 77.6644%-119 - C1 -2VTS 6.2 CDK2_HUMAN
16 PsiBlast_PDB 77.5744%-120 - C1 -1FVT 5.2 CDK2_HUMAN
94 PsiBlast_CBE 77.1944%-117 - C1 -2VTO 4.6 CDK2_HUMAN
64 PsiBlast_CBE 77.1244%-117 - C1 -3NS9 6.5 CDK2_HUMAN
12 PsiBlast_PDB 76.8644%-121 - C1 -1CKP 5.0 CDK2_HUMAN
34 PsiBlast_CBE 76.6744%-114 - C1 -4LYN 6.2 CDK2_HUMAN
97 PsiBlast_CBE 76.5644%-110 - C1 -2VTL 3.4 CDK2_HUMAN
58 PsiBlast_CBE 76.4444%-115 - C1 -3TIZ 5.5 CDK2_HUMAN
84 PsiBlast_CBE 76.4044%-119 - C1 -2W1H 6.7 CDK2_HUMAN
79 PsiBlast_CBE 76.2844%-113 - C1 -2XMY 5.7 CDK2_HUMAN
53 PsiBlast_CBE 76.2344%-124 - C1 -4BGH 5.5 CDK2_HUMAN
96 PsiBlast_CBE 76.1544%-112 - C1 -2VTM 3.4 CDK2_HUMAN
35 PsiBlast_CBE 76.0844%-109 - C1 -4KD1 7.4 CDK2_HUMAN
91 PsiBlast_CBE 76.0144%-110 - C1 -2VTR 5.2 CDK2_HUMAN
93 PsiBlast_CBE 75.8844%-120 - C1 -2VTP 4.7 CDK2_HUMAN
4 PsiBlast_PDB 75.8844%-113 - C1 -2BPM 3.6 CDK2_HUMAN
65 PsiBlast_CBE 75.8644%-113 - C1 -3LFS 5.9 CDK2_HUMAN
100 PsiBlast_CBE 75.8344%-119 - C1 -2VTH 3.3 CDK2_HUMAN
67 PsiBlast_CBE 75.7744%-118 - C1 -3LFN 7.8 CDK2_HUMAN
27 PsiBlast_CBE 75.6944%-116 - C1 -2WIH 8.2 CDK2_HUMAN
51 PsiBlast_CBE 75.5744%-119 - C1 -4D1X 4.7 CDK2_HUMAN
57 PsiBlast_CBE 75.5344%-119 - C1 -3ULI 6.9 CDK2_HUMAN
54 PsiBlast_CBE 75.5344%-119 - C1 -3WBL 6.0 CDK2_HUMAN
66 PsiBlast_CBE 75.5244%-115 - C1 -3LFQ 5.8 CDK2_HUMAN
59 PsiBlast_CBE 75.4544%-114 - C1 -3TIY 3.6 CDK2_HUMAN
99 PsiBlast_CBE 75.3944%-122 - C1 -2VTI 4.8 CDK2_HUMAN
92 PsiBlast_CBE 75.3344%-120 - C1 -2VTQ 5.6 CDK2_HUMAN
71 PsiBlast_CBE 75.1844%-115 - C1 -3F5X 8.4 CDK2_HUMAN
63 PsiBlast_CBE 75.1744%-120 - C1 -3S2P 3.9 CDK2_HUMAN
3 PsiBlast_PDB 75.1544%-112 - C1 -2C4G 5.4 CDK2_HUMAN
6 PsiBlast_PDB 75.1344%-112 - C1 -2WIH 8.7 CDK2_HUMAN
25 PsiBlast_CBE 75.1144%-116 - C1 -2WPA 5.9 CDK2_HUMAN
9 PsiBlast_PDB 75.0544%-115 - C1 -2WXV 7.4 CDK2_HUMAN
5 PsiBlast_PDB 74.9844%-113 - C1 -2BKZ 4.9 CDK2_HUMAN
30 PsiBlast_CBE 74.8944%-114 - C1 -2BKZ 5.0 CDK2_HUMAN
28 PsiBlast_CBE 74.8144%-115 - C1 -2C4G 5.1 CDK2_HUMAN
8 PsiBlast_PDB 74.6344%-111 - C1 -2WPA 6.0 CDK2_HUMAN
2 PsiBlast_PDB 74.6144%-110 - C1 -1VYW 5.7 CDK2_HUMAN
60 PsiBlast_CBE 74.6044%-112 - C1 -3TI1 6.1 CDK2_HUMAN
52 PsiBlast_CBE 74.5344%-121 - C1 -4BZD 7.8 CDK2_HUMAN
98 PsiBlast_CBE 74.5044%-120 - C1 -2VTJ 3.8 CDK2_HUMAN
78 PsiBlast_CBE 74.4544%-113 - C1 -2XNB 7.6 CDK2_HUMAN
17 PsiBlast_PDB 74.4544%-111 - C1 -1FVV 6.4 CDK2_HUMAN
89 PsiBlast_CBE 74.4144%-115 - C1 -2VU3 6.2 CDK2_HUMAN
14 PsiBlast_PDB 74.3244%-119 - C1 -1DI8 6.5 CDK2_HUMAN
56 PsiBlast_CBE 74.2144%-111 - C1 -3UNJ 7.0 CDK2_HUMAN
72 PsiBlast_CBE 74.1944%-114 - C1 -3F5X 7.7 CDK2_HUMAN
29 PsiBlast_CBE 74.1044%-116 - C1 -2BPM 5.5 CDK2_HUMAN
24 PsiBlast_CBE 74.0844%-116 - C1 -2WXV 6.8 CDK2_HUMAN
74 PsiBlast_CBE 73.9944%-114 - C1 -3EOC 6.5 CDK2_HUMAN
36 PsiBlast_CBE 73.9844%-111 - C1 -4FX3 6.4 CDK2_HUMAN
31 PsiBlast_CBE 73.9244%-116 - C1 -1VYW 5.3 CDK2_HUMAN
76 PsiBlast_CBE 73.4744%-113 - C1 -3EJ1 5.8 CDK2_HUMAN
75 PsiBlast_CBE 73.3744%-114 - C1 -3EJ1 6.0 CDK2_HUMAN
77 PsiBlast_CBE 73.3044%-116 - C1 -3EID 7.3 CDK2_HUMAN
37 PsiBlast_CBE 73.2544%-112 - C1 -4FX3 6.5 CDK2_HUMAN
73 PsiBlast_CBE 73.1044%-115 - C1 -3EOC 5.1 CDK2_HUMAN
20 PsiBlast_PDB 73.0544%-121 - C1 -1JVP 5.3 CDK2_HUMAN
19 PsiBlast_PDB 72.8644%-116 - C1 -1G5S 8.3 CDK2_HUMAN
119 HHSearch 72.8441%-126 - C1 -4F6U 9.1 CDK8_HUMAN
81 PsiBlast_CBE 72.6744%-111 - C1 -2X1N 6.7 CDK2_HUMAN
11 PsiBlast_PDB 72.5544%-111 - C1 -1FIN 3.7 CDK2_HUMAN
83 PsiBlast_CBE 72.5344%-110 - C1 -2WEV 6.2 CDK2_HUMAN
33 PsiBlast_CBE 72.4744%-117 - C1 -5A14 11.1 ?
26 PsiBlast_CBE 71.9944%-116 - C1 -2WIP 7.3 CDK2_HUMAN
7 PsiBlast_PDB 71.7044%-112 - C1 -2WIP 7.4 CDK2_HUMAN
55 PsiBlast_CBE 71.5444%-107 - C1 -3UNK 6.8 CDK2_HUMAN
10 PsiBlast_PDB 71.5344%-121 - C1 -1OIT 5.9 CDK2_HUMAN
95 PsiBlast_CBE 71.4944%-115 - C1 -2VTN 4.2 CDK2_HUMAN
87 PsiBlast_CBE 70.8244%-123 - C1 -2W05 7.0 CDK2_HUMAN
118 HHSearch 70.4146%-123 - C1 -4AU8 4.7 CDK5_HUMAN
132 HHSearch 69.7446%-119 - C1 -3NIZ 4.8 ?
32 PsiBlast_CBE 67.8444%-122 - C1 -5D1J 6.5 ?
130 HHSearch 66.3736%-129 - C1 -2B9H 5.6 FUS3_YEAST
116 HHSearch 64.4435%-119 - C1 -4IC7 4.9 MK07_HUMAN
128 HHSearch 61.7137%-127 - C1 -1J1B 4.6 GSK3B_HUMAN
122 HHSearch 60.0437%-124 - C1 -2FST - MK14_HUMAN
45 PsiBlast_CBE 44.2144% -19 - C1 -4FKJ 3.8 CDK2_HUMAN
43 PsiBlast_CBE 44.0244% -17 - C1 -4FKO 4.3 CDK2_HUMAN
61 PsiBlast_CBE 43.8344% -22 - C1 -3SW7 3.8 CDK2_HUMAN
46 PsiBlast_CBE 43.6344% -17 - C1 -4FKG 4.5 CDK2_HUMAN
68 PsiBlast_CBE 43.2744% -16 - C1 -3IGG 3.6 CDK2_HUMAN
48 PsiBlast_CBE 43.2344% -21 - C1 -4EK6 4.4 CDK2_HUMAN
88 PsiBlast_CBE 42.7744% -20 - C1 -2VV9 4.9 CDK2_HUMAN
39 PsiBlast_CBE 42.7344% -18 - C1 -4FKV 3.3 CDK2_HUMAN
49 PsiBlast_CBE 42.3744% -17 - C1 -4EK5 2.5 CDK2_HUMAN
38 PsiBlast_CBE 42.3344% -17 - C1 -4FKW 0.7 CDK2_HUMAN
69 PsiBlast_CBE 42.3044% -15 - C1 -3IG7 5.0 CDK2_HUMAN
40 PsiBlast_CBE 42.0144% -18 - C1 -4FKR 4.9 CDK2_HUMAN
41 PsiBlast_CBE 41.4644% -21 - C1 -4FKQ 4.0 CDK2_HUMAN
50 PsiBlast_CBE 41.2844% -13 - C1 -4EK4 2.5 CDK2_HUMAN
85 PsiBlast_CBE 40.1644% -22 - C1 -2W17 3.5 CDK2_HUMAN