@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 137_tII_ARATH: (2014-05-02 )
TEVKLSGGEADVTCDAVQLSSCATPMLTGVPPSTECCGKLKEQQPCFCTYIKDPRYSQYVGSANAKKTLATCGVPYPTC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
11 HHSearch 89.1652%-102 - C4 -1N89 5.8 NLT2G_WHEAT
12 HHSearch 82.2746%-119 - C4 -1L6H - NLTPX_ORYSJ -
1 Fugue 82.0545%-119 - C4 -1L6H - NLTPX_ORYSJ -
24 SP3 79.5239%-119 - C4 -1L6H - NLTPX_ORYSJ -
19 HHSearch 78.8632% -88 - C4 -1T12 - NLTP1_TOBAC -
29 SP3 77.5221%-112 - C4 -1S6D - 2SS8_HELAN -
13 HHSearch 74.6427% -82 - C4 -2RKN - DIRL1_ARATH -
16 HHSearch 70.0930% -87 - C4 -2ALG - NLTP1_PRUPE -
2 Fugue 69.3423% -77 - C4 -2RKN - DIRL1_ARATH -
3 Fugue 66.4317% -73 - C4 -1S6D - 2SS8_HELAN -
17 HHSearch 65.7425% -80 - C4 -1AFH - NLTP_MAIZE -
20 HHSearch 64.9823% -88 - C4 -1HYP - HPSE_SOYBN -
25 SP3 61.2417% -63 * C4 *1FK5 - NLTP_MAIZE -
14 HHSearch 57.6726% -41 - C4 -1BWO - NLTP1_WHEAT -
18 HHSearch 56.1623% -39 - C4 -1SIY - NLTP1_VIGRR -
32 SP3 54.6613% -55 - C4 -1PS6 - PDXA_ECOLI -
30 SP3 48.9017% -30 - C4 -1KNG - CYCY_BRADU -
10 Fugue 45.9516% -46 - C2 -2OPC - ? -
27 SP3 45.4912% -65 - C4 -1U78 - TC3A_CAEEL -
6 Fugue 45.2717% -17 * C5 *1SJW - ? -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
38 58.67100% -13 - C- -M038 - -
41 53.83100% -8 - C- -M041 - -
39 52.89100% -17 - C- -M039 - -