@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : new_query: (2014-05-07 )
VTCGQVASGLASCIPYLKTGGTPPPKCCSGVKAIKSLAITPADRKTICGCLKSGYSSSYNPSLAASLPGKCGVSVPYKISPDTDCSKVQ

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
21 HHSearch 95.6154%-117 - C4 -2ALG 3.4 NLTP1_PRUPE
25 HHSearch 93.7257%-122 - C4 -1T12 - NLTP1_TOBAC -
11 SP3 92.3351%-112 - C4 -1FK5 5.6 NLTP_MAIZE
22 HHSearch 91.8551%-127 - C4 -1SIY - NLTP1_VIGRR -
26 HHSearch 85.7541%-116 - C4 -1BWO - NLTP1_WHEAT -
23 HHSearch 85.4252%-105 - C4 -1AFH - NLTP_MAIZE -
33 HHSearch 58.3023%-119 - C4 -1BEA - ITRF_MAIZE -
27 HHSearch 57.8929%-104 - C4 -2RKN - DIRL1_ARATH -
32 HHSearch 54.4719%-113 - C4 -1B1U - IAAT_ELECO -
3 Fugue 54.4627%-116 - C4 -1L6H - NLTPX_ORYSJ -
2 Fugue 53.1630% -95 - C4 -2RKN - DIRL1_ARATH -
36 HHSearch 51.5523%-110 - C4 -1SM7 - ? -
39 HHSearch 51.4722% -86 - C4 -2LVF - ? -
41 HHSearch 51.2724%-110 - C4 -1S6D - 2SS8_HELAN -
40 HHSearch 51.0219% -83 - C4 -1W2Q - CONG_ARAHY -
18 SP3 48.7313%-117 - C4 -1QPO - NADC_MYCTU -
13 SP3 48.1920% -88 - C4 -1L6H - NLTPX_ORYSJ -
35 HHSearch 47.3324% -78 - C4 -1PSY - 2SS_RICCO -
15 SP3 47.1713%-117 - C4 -1QPO - NADC_MYCTU -
6 Fugue 44.5716% -59 - C4 -1W2Q - CONG_ARAHY -


User Run . : Multi Template Modeling Result:

(3 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OLA_A_2(1FK5)
NLTP_MAIZE
[Raw transfer]



DAO_E_5(2ALG)
NLTP1_PRUPE
[Raw transfer]
42 100.00100%-127 - C- -M042 - -
48 97.16100%-134 - C- -M048 - -
46 95.69100%-124 - C- -M046 - -