@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : 546_tII_HORVU: (2014-05-10 )
APCEVGQLTVCMPAITTGAKPSGACCANLGAQQGCFCQYAKDPALGRYITSPHARDTLLSCGLAVPRC

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
1 HHSearch 91.9473%-132 - C4 -1N89 6.7 NLT2G_WHEAT
2 HHSearch 88.7962%-138 - C4 -1L6H - NLTPX_ORYSJ -
25 SP3 88.2161%-138 - C4 -1L6H - NLTPX_ORYSJ -
15 Fugue 88.2161%-138 - C4 -1L6H - NLTPX_ORYSJ -
16 Fugue 77.9733%-129 - C4 -2RKN - DIRL1_ARATH -
3 HHSearch 75.5233%-126 - C4 -2RKN - DIRL1_ARATH -
9 HHSearch 64.3032%-117 - C4 -1T12 - NLTP1_TOBAC -
8 HHSearch 61.3422%-109 - C4 -1AFH - NLTP_MAIZE -
11 HHSearch 60.2229%-127 - C4 -1HYP - HPSE_SOYBN -
26 SP3 57.7419% -98 - C4 -1FK5 - NLTP_MAIZE -
5 HHSearch 55.1625% -94 - C4 -1SIY - NLTP1_VIGRR -
7 HHSearch 54.6426%-100 - C4 -2ALG - NLTP1_PRUPE -
4 HHSearch 53.1225% -71 - C4 -1BWO - NLTP1_WHEAT -
19 Fugue 51.4725% -92 - C1 -1CWV - -
21 Fugue 49.9114% -89 - C4 -1S6D - 2SS8_HELAN -
27 SP3 47.6310% -97 - C4 -1U78 - TC3A_CAEEL -
30 SP3 43.8516%-101 - C4 -1F9M - TRXF_SPIOL -
18 Fugue 43.2225% -69 - C3 -2JTM - CREN7_SULSO -
33 SP3 42.7011%-104 * C4 *1TC3 - TC3A_CAEEL -
24 Fugue 42.5311% -80 * C5 *3FBI - MED31_YEAST -


User Run . : Multi Template Modeling Result:

(4 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGM_B_2(1N89)
NLT2G_WHEAT
[Raw transfer]
39 94.27100%-134 - C- -M039 - -
42 91.43100%-142 - C- -M042 - -
40 90.57100%-141 - C- -M040 - -
41 90.56100%-138 - C- -M041 - -