@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo0184: (2016-03-13 )
MKEKDWWKKSVVYQIYPKSFNDSNGDGVGDIQGIIEKLDYLKELGVDVIWLSPVYDSPQDDNGYDIRDYQKIYEEYGDMATFDQLLQGLHDRDMKLVMDLVVNHTSDEHKWFEESRKSKDNPYRDYYFWREENEINNWGSIFSGPAWELDEKTGEYYLHLFSKKQPDLNWENPKLRQDVYNMMKFWLDKGIDGFRMDVINFISKNTDFPDGPVPDGQIYGDAGNDFCNGPRIHEFLQEMNQEVTSKYDVMTVGEMPGASTTDAQIYTNPANNEVDMIFTFEHMNLDSDSDNKWDLKPIYLPDLKENMSEWQVALQENGWNSLYWNNHDQPRIVSRFGNDNRFRVRSAKMLATCLHMMKGTPYIYQGEEIGMTNVHFETLDDYRDIETLNMYKERKEQGHSHESIMQSIYTKGRDNARTPYQWDNSENAGFTTGTPWLKVNPRYTEINNEEALKNPDSIFYYYQNLIKLRKTTEIITTGNYRLLLPKDEAIFAYERYTENEKLVVLCNFTEEEQVISDETILNEIQKGSVLVNNVPNIIEGTLRPYEAIVYQIK

Atome Classification :

(63 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUC_A_4(4H8U)
?
[Raw transfer]




SUC_A_3(2PWE)
?
[Raw transfer]




SUC_B_4(2PWE)
?
[Raw transfer]




ISL_A_4(4HA1)
?
[Raw transfer]




TEU_A_4(4H8V)
?
[Raw transfer]




MAL_A_7(3WY4)
?
[Raw transfer]




SUC_A_4(4HPH)
?
[Raw transfer]




GLC_B_6(4H7V)
?
[Raw transfer]




GLC_A_2(3AXI)
MALX3_YEAST
[Raw transfer]




GLC_A_2(3A4A)
MALX3_YEAST
[Raw transfer]




TEU_B_6(4H8V)
?
[Raw transfer]




CTS_B_6(2PWG)
?
[Raw transfer]




BGC_B_10(3WY3)
?
[Raw transfer]




GLC_A_4(4HOZ)
?
[Raw transfer]




GLC_A_4(4H7V)
?
[Raw transfer]




SUGAR_A_2(2ZID)
DEXB_STRMU
[Raw transfer]

-

NOJ_B_6(2PWD)
?
[Raw transfer]




CTS_A_5(2PWG)
?
[Raw transfer]




GLC_A_4(4HP5)
?
[Raw transfer]




NOJ_A_11(3GBE)
?
[Raw transfer]




NOJ_A_5(2PWD)
?
[Raw transfer]




BGC_A_6(3WY3)
?
[Raw transfer]




GOL_A_5(4GI8)
?
[Raw transfer]




GLC_B_6(4HA1)
?
[Raw transfer]




TEU_B_6(4H8U)
?
[Raw transfer]




GOL_B_8(4GI9)
?
[Raw transfer]




GOL_A_5(4GI9)
?
[Raw transfer]




GOL_A_5(4GIA)
?
[Raw transfer]




TRS_B_6(4GO8)
?
[Raw transfer]




GOL_A_5(4GI6)
?
[Raw transfer]




GOL_B_15(4GI8)
?
[Raw transfer]




GOL_B_12(4GIA)
?
[Raw transfer]




GOL_A_3(4GIN)
?
[Raw transfer]




TRS_B_6(1ZJA)
?
[Raw transfer]




BGC_A_8(3WY2)
?
[Raw transfer]




BGC_A_2(4WLC)
?
[Raw transfer]




TRS_A_4(4GO8)
?
[Raw transfer]




BGC_A_8(3WY2)
?
[Raw transfer]




TRS_B_6(1ZJB)
?
[Raw transfer]




GOL_A_3(4H2C)
?
[Raw transfer]




GOL_A_3(4HOW)
?
[Raw transfer]




TRS_A_5(1ZJB)
?
[Raw transfer]




GOL_B_7(4H8H)
?
[Raw transfer]




TRS_A_2(4M8U)
O16G1_BACSU
[Raw transfer]




GOL_A_3(4M8U)
O16G1_BACSU
[Raw transfer]




TRS_A_5(2ZIC)
DEXB_STRMU
[Raw transfer]




TRS_B_6(4GO9)
?
[Raw transfer]




GOL_B_11(3WY2)
?
[Raw transfer]




TRS_A_4(4GO9)
?
[Raw transfer]




TRS_A_2(4MB1)
O16G1_BACSU
[Raw transfer]




TRS_A_2(4HOX)
?
[Raw transfer]




TRS_A_5(1ZJA)
?
[Raw transfer]




TRS_A_5(1ZJA)
?
[Raw transfer]




GLO_B_7(4M56)
O16G1_BACSU
[Raw transfer]




TRS_A_2(4MAZ)
O16G1_BACSU
[Raw transfer]




GOL_A_7(4H2C)
?
[Raw transfer]




PRU_B_7(3WY1)
?
[Raw transfer]




PRU_A_5(3WY1)
?
[Raw transfer]




EDO_A_4(3GBD)
?
[Raw transfer]




EDO_A_2(3GBD)
?
[Raw transfer]




GLC_A_3(3AXH)
MALX3_YEAST
[Raw transfer]




TRS_B_9(4GI6)
?
[Raw transfer]




1 PsiBlast_PDB 90.1763% -64 - C1 -1UOK - O16G_BACCE -
76 HHSearch 86.6064% -58 - C1 -1UOK - O16G_BACCE -
3 PsiBlast_PDB 86.3954% -62 - C1 -4MB1 3.4 O16G1_BACSU
2 PsiBlast_PDB 85.8154% -62 - C1 -4M8U 3.1 O16G1_BACSU
4 PsiBlast_PDB 84.7353% -62 - C1 -4MAZ 2.9 O16G1_BACSU
21 PsiBlast_CBE 83.9254% -61 - C1 -4M56 2.8 O16G1_BACSU
30 PsiBlast_CBE 82.4144% -65 - C1 -4H2C 3.9 ?
40 PsiBlast_CBE 81.7744% -60 - C1 -4GI9 2.5 ?
28 PsiBlast_CBE 81.5344% -61 - C1 -2PWG 3.3 ?
50 PsiBlast_CBE 81.4743% -60 - C1 -4H8H - ? -
46 PsiBlast_CBE 81.4344% -60 - C1 -2PWF - ? -
20 PsiBlast_PDB 81.4144% -64 - C1 -4GIN 2.9 ?
55 PsiBlast_CBE 81.3243% -62 * C1 *4H7V 3.4 ?
39 PsiBlast_CBE 81.2444% -60 - C1 -4GI9 2.9 ?
34 PsiBlast_CBE 81.1944% -61 - C1 -4GO9 4.4 ?
33 PsiBlast_CBE 81.1244% -60 - C1 -4GO9 3.0 ?
52 PsiBlast_CBE 80.9843% -62 - C1 -4HA1 3.9 ?
42 PsiBlast_CBE 80.9344% -60 - C1 -4GI8 4.2 ?
23 PsiBlast_CBE 80.9244% -60 - C1 -2PWD 4.0 ?
17 PsiBlast_PDB 80.9144% -61 - C1 -1ZJB 4.3 ?
38 PsiBlast_CBE 80.7944% -59 - C1 -4GIA 3.0 ?
31 PsiBlast_CBE 80.7744% -60 - C1 -2PWE 3.8 ?
29 PsiBlast_CBE 80.7744% -60 - C1 -2PWG 3.0 ?
53 PsiBlast_CBE 80.7543% -60 - C1 -4H8U 3.1 ?
32 PsiBlast_CBE 80.7544% -60 - C1 -2PWE 3.7 ?
22 PsiBlast_CBE 80.6244% -59 - C1 -4H8V 3.7 ?
6 PsiBlast_PDB 80.5349% -61 - C1 -4WLC 4.7 ?
14 PsiBlast_PDB 80.5045% -58 - C1 -3GBD 3.0 ?
41 PsiBlast_CBE 80.4144% -58 - C1 -4GI8 3.0 ?
24 PsiBlast_CBE 80.4044% -60 - C1 -1ZJB 4.3 ?
19 PsiBlast_PDB 80.3344% -60 - C1 -4H8V 4.3 ?
25 PsiBlast_CBE 80.3144% -62 - C1 -1ZJA 4.4 ?
5 PsiBlast_PDB 80.2949% -63 - C1 -2ZIC 3.5 DEXB_STRMU
8 PsiBlast_PDB 80.2549% -61 - C1 -2ZID 5.5 DEXB_STRMU
54 PsiBlast_CBE 80.1943% -60 - C1 -4H8U 3.2 ?
37 PsiBlast_CBE 80.0044% -59 - C1 -4GIA 2.9 ?
43 PsiBlast_CBE 79.9544% -58 - C1 -4GI6 3.0 ?
35 PsiBlast_CBE 79.8144% -58 - C1 -4GO8 4.3 ?
49 PsiBlast_CBE 79.7743% -61 - C1 -4H8H 2.2 ?
36 PsiBlast_CBE 79.6744% -59 - C1 -4GO8 2.9 ?
12 PsiBlast_PDB 79.6144% -58 - C1 -4HP5 4.9 ?
11 PsiBlast_PDB 79.5444% -55 - C1 -4HPH 4.2 ?
18 PsiBlast_PDB 79.4144% -59 - C1 -2PWD 4.0 ?
9 PsiBlast_PDB 79.1744% -56 - C1 -4HOW 3.1 ?
51 PsiBlast_CBE 79.1143% -60 - C1 -4HA1 4.2 ?
44 PsiBlast_CBE 79.0644% -58 - C1 -4GI6 2.6 ?
16 PsiBlast_PDB 79.0644% -59 - C1 -1ZJA 2.7 ?
10 PsiBlast_PDB 78.5644% -56 - C1 -4HOX 3.0 ?
56 PsiBlast_CBE 78.4043% -59 - C1 -4H7V 4.8 ?
13 PsiBlast_PDB 78.2544% -57 - C1 -4HOZ 4.0 ?
15 PsiBlast_PDB 77.3145% -54 - C1 -3GBE 3.4 ?
79 HHSearch 76.8945% -52 - C1 -1ZJA 2.7 ?
60 PsiBlast_CBE 71.6540% -51 - C1 -3AXI 3.7 MALX3_YEAST
58 PsiBlast_CBE 71.3440% -51 - C1 -3A4A 4.0 MALX3_YEAST
61 PsiBlast_CBE 70.4840% -52 - C1 -3AXH 3.0 MALX3_YEAST
64 PsiBlast_CBE 62.2731% -56 - C1 -3WY1 2.4 ?
62 PsiBlast_CBE 61.5831% -53 - C1 -3WY2 3.2 ?
65 PsiBlast_CBE 61.5431% -55 - C1 -3WY1 3.0 ?
67 PsiBlast_CBE 61.2231% -51 - C1 -3WY3 4.0 ?
68 PsiBlast_CBE 60.9231% -52 - C1 -3WY3 4.0 ?
66 PsiBlast_CBE 59.9431% -51 - C1 -3WY4 4.1 ?
63 PsiBlast_CBE 59.1731% -51 - C1 -3WY2 3.8 ?
80 HHSearch 59.1133% -52 - C1 -3WY2 3.7 ?