@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1906: (2016-03-30 )
MHIALIAHDEKKDLMVGFATAYKHLLEPHQLYATGTTGLRIIEATGLTVHRFKSGPLGGDQQIGARISENKMDLVIFLRDPLTAQPHEPDVTALIRLCDVYEIPLATNIGTAEILIRGLGAGFLDWRDLRRNDE

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGH_K_11(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_G_7(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_I_9(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_L_12(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_J_10(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_H_8(1IK4)
MGSA_ECOLI
[Raw transfer]




PGA_K_11(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_I_9(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_G_7(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_L_12(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_J_10(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_J_10(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_J_10(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_I_9(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_K_11(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_G_7(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_H_8(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_H_8(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_H_8(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_K_11(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_I_9(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_L_12(1S89)
MGSA_ECOLI
[Raw transfer]




FMT_M_13(1B93)
MGSA_ECOLI
[Raw transfer]




PGA_L_12(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_G_7(1S8A)
MGSA_ECOLI
[Raw transfer]




FMT_K_11(1B93)
MGSA_ECOLI
[Raw transfer]




FMT_N_14(1B93)
MGSA_ECOLI
[Raw transfer]




FMT_J_10(1B93)
MGSA_ECOLI
[Raw transfer]




45 HHSearch 90.1060%-124 * C6 *2XW6 - ? -
43 HHSearch 89.7049%-125 - C6 -1B93 3.1 MGSA_ECOLI
44 HHSearch 88.9148%-129 - C6 -1VMD - MGSA_THEMA -
3 PsiBlast_PDB 88.8463%-135 - C6 -1WO8 - MGSA_THET8 -
21 PsiBlast_CBE 88.0454%-135 - C6 -1IK4 3.4 MGSA_ECOLI
14 PsiBlast_CBE 87.9663%-138 - C6 -1WO8 - MGSA_THET8 -
64 Fugue 87.9147%-120 - C6 -1B93 - MGSA_ECOLI -
63 Fugue 87.9147%-120 - C6 -1B93 - MGSA_ECOLI -
16 PsiBlast_CBE 87.8763%-133 - C6 -1WO8 - MGSA_THET8 -
18 PsiBlast_CBE 87.7263%-134 - C6 -1WO8 - MGSA_THET8 -
23 PsiBlast_CBE 87.6654%-134 - C6 -1IK4 4.4 MGSA_ECOLI
36 PsiBlast_CBE 87.6153%-131 - C6 -1S8A 3.5 MGSA_ECOLI
13 PsiBlast_CBE 87.6063%-132 - C6 -2XW6 - ? -
29 PsiBlast_CBE 87.5854%-131 - C6 -1B93 3.0 MGSA_ECOLI
17 PsiBlast_CBE 87.5263%-137 - C6 -1WO8 - MGSA_THET8 -
25 PsiBlast_CBE 87.4554%-134 - C6 -1EGH 3.7 MGSA_ECOLI
7 PsiBlast_PDB 87.1853%-131 - C6 -1S89 3.7 MGSA_ECOLI
8 PsiBlast_PDB 87.1753%-135 - C6 -1S8A 3.5 MGSA_ECOLI
24 PsiBlast_CBE 86.9754%-133 - C6 -1EGH 3.5 MGSA_ECOLI
2 PsiBlast_PDB 86.9563%-126 - C6 -2XW6 - ? -
5 PsiBlast_PDB 86.8154%-133 - C6 -1EGH 3.5 MGSA_ECOLI
26 PsiBlast_CBE 86.7154%-133 - C6 -1EGH 3.6 MGSA_ECOLI
28 PsiBlast_CBE 86.6354%-132 - C6 -1EGH 3.8 MGSA_ECOLI
37 PsiBlast_CBE 86.5753%-131 - C6 -1S8A 3.7 MGSA_ECOLI
30 PsiBlast_CBE 86.4254%-131 - C6 -1B93 3.3 MGSA_ECOLI
6 PsiBlast_PDB 86.3454%-131 - C6 -1IK4 3.6 MGSA_ECOLI
40 PsiBlast_CBE 86.0253%-132 - C6 -1S8A 3.8 MGSA_ECOLI
32 PsiBlast_CBE 85.9853%-130 - C6 -1S89 3.7 MGSA_ECOLI
27 PsiBlast_CBE 85.9754%-133 - C6 -1EGH 3.6 MGSA_ECOLI
34 PsiBlast_CBE 85.9653%-134 - C6 -1S89 3.5 MGSA_ECOLI
35 PsiBlast_CBE 85.9353%-131 - C6 -1S89 3.7 MGSA_ECOLI
31 PsiBlast_CBE 85.8753%-130 - C6 -1S89 3.6 MGSA_ECOLI
22 PsiBlast_CBE 85.5854%-134 - C6 -1IK4 3.6 MGSA_ECOLI
38 PsiBlast_CBE 85.4253%-133 - C6 -1S8A 3.2 MGSA_ECOLI
33 PsiBlast_CBE 85.4153%-133 - C6 -1S89 3.5 MGSA_ECOLI
20 PsiBlast_CBE 85.4154%-130 - C6 -1IK4 3.7 MGSA_ECOLI
19 PsiBlast_CBE 85.3454%-130 - C6 -1IK4 3.4 MGSA_ECOLI
39 PsiBlast_CBE 85.3353%-132 - C6 -1S8A 3.7 MGSA_ECOLI