@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1976: (2016-03-30 )
MNPFLKNKTVLITGASNGLGAEIARQVAMSGGNVIITARSTKKLIELQKDIHDKFSVEATYFTLDMTDFEQVKQVSAEINASYQIDVLVNCAGFGLFENAIDIPFETIEKMFDTNVLGLIQLTQLILPQMQARKAGHIINIASQAAKIATPKSTVYSATKYAVLGFSNALRLELMPDKINVTTINPGPIATNFFDVADKSSNYLETVGKLVLKPEKVAHKTVQIMGTKRREINLPFVMNIATRLYQVMPQVIEFFGKGAFLKK

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_5(3RKU)
YM71_YEAST
[Raw transfer]




NDP_B_7(2JAP)
?
[Raw transfer]




NDP_C_9(2JAP)
?
[Raw transfer]




NDP_A_5(2JAP)
?
[Raw transfer]




NAP_D_8(3RKU)
YM71_YEAST
[Raw transfer]




NDP_D_11(2JAP)
?
[Raw transfer]




NAP_B_6(3RKU)
YM71_YEAST
[Raw transfer]




NAP_C_7(3RKU)
YM71_YEAST
[Raw transfer]




NAP_B_7(4QEC)
?
[Raw transfer]




NAP_C_7(3P19)
?
[Raw transfer]




NAP_B_6(4QED)
?
[Raw transfer]




NAP_B_6(3P19)
?
[Raw transfer]




NAP_A_5(3P19)
?
[Raw transfer]




NAP_A_3(4QEC)
?
[Raw transfer]




NAP_D_8(3P19)
?
[Raw transfer]




28 PsiBlast_CBE 82.2434% -97 - C1 -3ASV - ? -
24 PsiBlast_CBE 80.9634% -96 - C1 -3ASV - ? -
3 PsiBlast_PDB 80.5134% -92 - C1 -3ASV - ? -
26 PsiBlast_CBE 80.3934% -96 - C1 -3ASV - ? -
27 PsiBlast_CBE 80.2434% -97 - C1 -3ASV - ? -
25 PsiBlast_CBE 80.2234% -98 - C1 -3ASV - ? -
2 PsiBlast_PDB 76.7734%-100 - C1 -3ASU - ? -
4 PsiBlast_PDB 76.4235% -99 - C1 -3M1A - ? -
1 PsiBlast_PDB 75.6540% -96 - C1 -3RKU 11.2 YM71_YEAST
79 PsiBlast_CBE 75.5034%-102 - C1 -2JAP 11.1 ?
76 PsiBlast_CBE 75.4834%-103 - C1 -2JAP 11.4 ?
87 HHSearch 75.1829% -89 - C1 -3AI3 - ? -
21 PsiBlast_CBE 75.0140% -97 - C1 -3RKU 12.7 YM71_YEAST
78 PsiBlast_CBE 74.3934%-102 - C1 -2JAP 9.5 ?
23 PsiBlast_CBE 73.6440% -98 - C1 -3RKU 13.0 YM71_YEAST
77 PsiBlast_CBE 73.2934%-100 - C1 -2JAP 10.0 ?
22 PsiBlast_CBE 72.6140% -96 - C1 -3RKU 12.9 YM71_YEAST
43 PsiBlast_CBE 71.8231% -99 - C1 -4DC1 - ACT3_STRCO -
6 PsiBlast_PDB 71.1232% -99 - C1 -3AI2 - ? -
35 PsiBlast_CBE 70.3832%-100 - C1 -3AI2 - ? -
64 PsiBlast_CBE 61.6332%-102 - C1 -4QEC 8.5 ?
66 PsiBlast_CBE 61.4032%-101 - C1 -4QED 8.0 ?
65 PsiBlast_CBE 59.4632% -98 - C1 -4QEC 8.2 ?
41 PsiBlast_CBE 51.4333% -86 - C1 -3P19 8.4 ?
11 PsiBlast_PDB 50.2333% -83 - C1 -3P19 10.3 ?
42 PsiBlast_CBE 49.5633% -86 - C1 -3P19 8.3 ?
40 PsiBlast_CBE 48.5533% -85 - C1 -3P19 11.3 ?