@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs0887: (2015-12-04 )
MSQITFKKVGLDNVNILQNLAIETFRQTFSHDNSEEQLQAFFNESYTLPVLKSEITHAESDTYFVYLDTDLVGYLKVNWGSQQTEKDLDKAFEIQRIYLLDAYQGKGIGKATFEFALDLAYKSGLDWAWLGVWEFNHKAQAFYAKYGFEKFSEHQFSVGDKVDTDWLLRKSLH

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_A_4(1TIQ)
PAIA_BACSU
[Raw transfer]




COA_A_5(1TIQ)
PAIA_BACSU
[Raw transfer]




COA_A_5(1TIQ)
PAIA_BACSU
[Raw transfer]




1 PsiBlast_PDB 92.8862%-114 - C2 -4E2A - ? -
2 PsiBlast_PDB 78.7236%-100 - C2 -1TIQ 9.6 PAIA_BACSU
28 HHSearch 77.8535% -96 * C2 *1TIQ 3.1 PAIA_BACSU
4 PsiBlast_PDB 64.6726%-121 - C2 -3K9U - PAIA_THEAC -
29 HHSearch 62.7917%-114 - C2 -3FNC - ? -
32 HHSearch 62.2817%-103 - C2 -1GHE - TTR_PSEAJ -
3 PsiBlast_PDB 61.6126%-108 - C2 -3F0A - PAIA_THEAC -
43 HHSearch 61.0617%-116 - C2 -3I9S - ? -
5 PsiBlast_PDB 60.9426%-111 - C2 -3NE7 - PAIA_THEAC -
6 PsiBlast_PDB 59.5826%-109 - C2 -3FIX - PAIA_THEAC -
31 HHSearch 59.3518% -83 - C2 -2CY2 - ? -
44 HHSearch 59.3419% -97 - C2 -2AE6 - ? -
46 HHSearch 58.9319% -92 - C2 -2I79 - ? -
49 Fugue 58.4118% -81 - C2 -2CY2 - ? -
52 Fugue 57.6615%-100 - C2 -1P0H - MSHD_MYCTU -
40 HHSearch 57.4819% -83 - C2 -2FIW - ? -
34 HHSearch 57.3015% -99 - C2 -2B5G - SAT1_HUMAN -
41 HHSearch 56.9415%-100 - C2 -3DSB - ? -
8 PsiBlast_PDB 56.8320% -74 - C2 -2CY2 - ? -
36 HHSearch 56.4117% -72 - C2 -1U6M - ? -