@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : gbs1628: (2015-12-09 )
MTMLKVENLSIHYGVIQAVNDVSFEVNQGEVVTLIGANGTGKTSILRTISGLVRPSQGSISFMGKPIHKLAARKIVGNGLAQVPEGRHVFSSLSVMENLEMGAFLQKDREQNQKMLKKVFDRFPRLEERKNQDAATLSGGEQQMLAMGRALMSRPKLLLLDEPSMGLAPIFIQEIFNIIEDIKKQGTTVLLVEQNANKALTIADKAYVLETGKVVLSGTGKELLVSDQVRKAYLGG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_2(1JI0)
?
[Raw transfer]




46 HHSearch 91.9755%-108 - C1 -1JI0 5.3 ?
1 PsiBlast_PDB 90.3953%-109 - C1 -1JI0 - ? -
8 PsiBlast_PDB 83.5533%-100 - C1 -4P32 - LPTB_ECOLI -
6 PsiBlast_PDB 81.8433%-100 - C1 -4QC2 - ? -
23 PsiBlast_CBE 81.5033%-101 - C1 -4P32 - LPTB_ECOLI -
22 PsiBlast_CBE 81.4533%-102 - C1 -4QC2 - ? -
24 PsiBlast_CBE 81.1732%-100 - C1 -4P33 - LPTB_ECOLI -
9 PsiBlast_PDB 80.9732% -99 - C1 -4P33 - LPTB_ECOLI -
21 PsiBlast_CBE 77.3936% -93 - C1 -4WBS - ? -
3 PsiBlast_PDB 75.5736% -98 - C1 -4WBS - ? -
52 HHSearch 75.3530% -97 - C1 -1G6H - LIVG_METJA -
2 PsiBlast_PDB 74.6629%-103 - C1 -1G6H - LIVG_METJA -
4 PsiBlast_PDB 71.3729% -95 - C1 -1GAJ - LIVG_METJA -
5 PsiBlast_PDB 67.7329% -95 - C1 -1G9X - LIVG_METJA -
27 PsiBlast_CBE 67.2832% -83 - C1 -4MKI - ECFA2_CALS4 -
28 PsiBlast_CBE 66.8732% -80 - C1 -4MKI - ECFA2_CALS4 -
36 HHSearch 66.7230% -82 - C1 -1Z47 - ? -
15 PsiBlast_PDB 66.0529% -90 - C1 -4YMW - ? -
14 PsiBlast_PDB 66.0329% -90 - C1 -4YMV - ? -
51 HHSearch 66.0225% -89 - C1 -2OLJ - ? -