@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00010: (2016-06-01 )
MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTSDFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_B_8(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_C_9(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_A_7(2Z4R)
DNAA_THEMA
[Raw transfer]




ADP_A_3(2Z4S)
DNAA_THEMA
[Raw transfer]




ADP_A_3(2Z4S)
DNAA_THEMA
[Raw transfer]




ADP_A_3(1L8Q)
DNAA_AQUAE
[Raw transfer]




ADP_A_3(1L8Q)
DNAA_AQUAE
[Raw transfer]




43 HHSearch 93.5738% -90 - C2 -1L8Q 8.0 DNAA_AQUAE
23 PsiBlast_CBE 93.0739% -90 - C2 -3R8F - DNAA_AQUAE -
24 PsiBlast_CBE 92.6639% -89 - C2 -3R8F - DNAA_AQUAE -
25 PsiBlast_CBE 92.4139% -88 - C2 -3R8F - DNAA_AQUAE -
3 PsiBlast_PDB 92.3139% -90 - C2 -3R8F - DNAA_AQUAE -
5 PsiBlast_PDB 91.8738% -90 - C2 -1L8Q 7.8 DNAA_AQUAE
26 PsiBlast_CBE 90.6539% -85 - C2 -2HCB - DNAA_AQUAE -
27 PsiBlast_CBE 90.2239% -86 - C2 -2HCB - DNAA_AQUAE -
4 PsiBlast_PDB 90.0239% -91 - C2 -2HCB - DNAA_AQUAE -
28 PsiBlast_CBE 89.8839% -86 - C2 -2HCB - DNAA_AQUAE -
1 PsiBlast_PDB 89.6637%-106 - C2 -2Z4R 6.7 DNAA_THEMA
2 PsiBlast_PDB 89.5437%-107 - C2 -2Z4S 7.3 DNAA_THEMA
22 PsiBlast_CBE 89.4237%-106 - C2 -2Z4R 7.5 DNAA_THEMA
21 PsiBlast_CBE 89.1837%-105 - C2 -2Z4R 7.2 DNAA_THEMA
42 HHSearch 88.6936%-105 - C2 -2Z4S 7.3 DNAA_THEMA
11 PsiBlast_PDB 65.0823% -69 - C2 -3SC3 - ? -
6 PsiBlast_PDB 64.92100%-102 - C1 -4TPS - DNAA_BACSU -
45 HHSearch 63.8619% -52 - C2 -4WW0 - FTSH_AQUAE -
58 HHSearch 59.9220% -86 - C2 -3PFI - RUVB_CAMJE -
55 HHSearch 59.5319% -73 - C2 -3B9P - -