@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu07230: (2016-06-11 )
MKHMLIAGGGIGGLSAAISLRKAGFSVTLCEAASENRKTGAGILQPQNALAVLKELGVFEDCCKHGFQTEWFKTFDEQGNLLFQVSESFLDDSLPGRNNILRKTLNDILMKHAEAVGVDIKWGKKVVAYEETAESVTALCEDGEKMQADILAGFDGIHSVVRDKMLQKETEKEHLGMGAWRFYIELPDYTFEDATFMYRSGDTQIGVVPLAQHAGYVFVLQPCTSDYWDEEDTRFDRVKEILSGFRGLDFVTKHMSKQHPVIFNKLEQVAVQEPWHKGRVIIGGDAAHAGAPTLAQGAAMAIEDAIVLAEELQNHADHETALQAYYKRRAPRALKVQNLSSEIVRRRLKGEPGAEELIGECYAVLREGY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_A_2(2RGJ)
?
[Raw transfer]




12 PsiBlast_PDB 94.9830% 0 - C- -3C96 - ? -
112 HHSearch 91.5628% 0 - C- -3C96 - ? -
136 Fugue 76.6330% -91 - C1 -4H2Q - ? -
138 Fugue 76.6030% -87 - C1 -4JY3 - ? -
135 Fugue 76.5930% -92 - C1 -4GF7 - ? -
137 Fugue 73.3426% -94 - C1 -3C96 - ? -
13 PsiBlast_PDB 72.7030%-106 - C1 -2RGJ 10.5 ?
7 PsiBlast_PDB 72.3929% -92 - C1 -4H2Q - ? -
9 PsiBlast_PDB 72.3229% -89 - C1 -4JY3 - ? -
6 PsiBlast_PDB 72.3029% -88 - C1 -4H2P - ? -
1 PsiBlast_PDB 72.2929% -91 - C1 -4H2N - ? -
5 PsiBlast_PDB 72.1729% -93 - C1 -4GF7 - ? -
8 PsiBlast_PDB 72.1229% -89 - C1 -4JY2 - ? -
3 PsiBlast_PDB 72.0829% -92 - C1 -3GMC - ? -
4 PsiBlast_PDB 71.9729% -91 - C1 -3ALJ - ? -
2 PsiBlast_PDB 71.8129% -89 - C1 -4H2R - ? -
14 PsiBlast_PDB 71.7229% -89 - C1 -3ALM - ? -
10 PsiBlast_PDB 70.6429% -88 - C1 -3ALL - ? -
11 PsiBlast_PDB 69.1030% -84 - C1 -3GMB - ? -
144 Fugue 68.5424% -88 - C1 -5FN0 - KMO_PSEFL -