@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10030: (2016-06-15 )
MHCAENCIFCKIIAGDIPSAKVYEDEHVLAFLDISQVTKGHTLVIPKTHIENVYEFTDELAKQYFHAVPKIARAIRDEFEPIGLNTLNNNGEKAGQSVFHYHMHIIPRYGKGDGFGAVWKTHADDYKPEDLQNISSSIAKRLASS

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

5GP_B_6(4EGU)
?
[Raw transfer]




5GP_A_3(4EGU)
?
[Raw transfer]




5GP_A_3(4EGU)
?
[Raw transfer]




5GP_A_9(3N1S)
HINT_ECOLI
[Raw transfer]




AMP_A_5(3O0M)
?
[Raw transfer]




AMP_B_8(3O0M)
?
[Raw transfer]




5GP_A_3(3OXK)
HIT_ENTHI
[Raw transfer]




AMP_A_3(3OMF)
HIT_ENTHI
[Raw transfer]




AMP_A_5(3O0M)
?
[Raw transfer]




ADN_A_2(3O1C)
HINT1_RABIT
[Raw transfer]




UNL_B_6(3LB5)
?
[Raw transfer]




UNL_A_5(3LB5)
?
[Raw transfer]




UNL_A_5(3LB5)
?
[Raw transfer]




EDO_A_6(3P0T)
?
[Raw transfer]




UNL_C_7(3LB5)
?
[Raw transfer]




EDO_A_7(3P0T)
?
[Raw transfer]




21 PsiBlast_CBE 91.05100%-136 - C3 -1Y23 - HIT_BACSU -
23 PsiBlast_CBE 90.81100%-137 - C3 -1Y23 - HIT_BACSU -
24 PsiBlast_CBE 90.62100%-139 - C3 -1Y23 - HIT_BACSU -
80 HHSearch 90.28100%-138 - C3 -1Y23 - HIT_BACSU -
1 PsiBlast_PDB 90.28100%-138 - C3 -1Y23 - HIT_BACSU -
22 PsiBlast_CBE 89.37100%-139 - C3 -1Y23 - HIT_BACSU -
25 PsiBlast_CBE 84.3266%-167 - C3 -3IMI - ? -
81 HHSearch 82.9267%-166 - C3 -3IMI - ? -
2 PsiBlast_PDB 82.6766%-166 - C3 -3IMI - ? -
27 PsiBlast_CBE 82.4066%-161 - C3 -3IMI - ? -
26 PsiBlast_CBE 81.7066%-160 - C3 -3IMI - ? -
89 HHSearch 73.8451%-143 - C3 -3L7X - ? -
4 PsiBlast_PDB 70.6643%-154 - C3 -3KSV - ? -
3 PsiBlast_PDB 70.5254%-146 - C3 -3L7X - ? -
7 PsiBlast_PDB 70.0542%-165 - C3 -2EO4 - ? -
82 HHSearch 68.2739%-153 - C3 -3KSV - ? -
83 HHSearch 67.5236%-136 - C3 -3LB5 2.6 ?
88 HHSearch 67.1436%-121 - C3 -3O0M 5.3 ?
91 HHSearch 66.4734%-129 - C3 -2EO4 - ? -
90 HHSearch 65.7932%-120 - C3 -3P0T 3.5 ?
28 PsiBlast_CBE 65.2643%-155 - C3 -3O0M 5.4 ?
5 PsiBlast_PDB 63.7843%-151 - C3 -3O0M 5.3 ?
100 HHSearch 61.5339%-155 - C3 -4EGU 6.9 ?
94 HHSearch 61.1333%-162 - C3 -3N1S 6.5 HINT_ECOLI
9 PsiBlast_PDB 61.1143%-180 - C3 -3OMF 5.5 HIT_ENTHI
6 PsiBlast_PDB 61.0243%-156 - C3 -3LB5 2.6 ?
30 PsiBlast_CBE 60.6943%-140 - C3 -3LB5 2.8 ?
31 PsiBlast_CBE 60.3643%-155 - C3 -3LB5 2.7 ?
11 PsiBlast_PDB 60.0340%-165 - C3 -4EGU 6.9 ?
10 PsiBlast_PDB 59.6943%-180 - C3 -3OXK 5.9 HIT_ENTHI
32 PsiBlast_CBE 59.1040%-173 - C3 -4EGU 6.9 ?
97 HHSearch 57.2132%-131 - C3 -3O1C 4.6 HINT1_RABIT