@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10970: (2016-06-17 )
MKIVRIETFPLFHRLEKPYGDANGFKRYRTCYLIRIITESGIDGWGECVDWLPALHVGFTKRIIPFLLGKQAGSRLSLVRTIQKWHQRAASAVSMALTEIAAKAADCSVCELWGGRYREEIPVYASFQSYSDSPQWISRSVSNVEAQLKKGFEQIKVKIGGTSFKEDVRHINALQHTAGSSITMILDANQSYDAAAAFKWERYFSEWTNIGWLEEPLPFDQPQDYAMLRSRLSVPVAGGENMKGPAQYVPLLSQRCLDIIQPDVMHVNGIDEFRDCLQLARYFGVRASAHAYDGSLSRLYALFAQACLPPWSKMKNDHIEPIEWDVMENPFTDLVSLQPSKGMVHIPKGKGIGTEINMEIVNRYKWDGSAY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AKG_A_4(3OP2)
?
[Raw transfer]



ACY_A_9(3OZY)
?
[Raw transfer]



GOL_A_4(2PP0)
TAGAD_SALTY
[Raw transfer]
26 PsiBlast_CBE 99.2199%-117 - C1 -2GGE - YITF_BACSU -
27 PsiBlast_CBE 98.7299%-116 - C1 -2GGE - YITF_BACSU -
1 PsiBlast_PDB 98.4199%-115 - C1 -2GDQ - YITF_BACSU -
2 PsiBlast_PDB 98.3099%-116 - C1 -2GGE - YITF_BACSU -
21 PsiBlast_CBE 97.9199%-116 - C1 -2GGE - YITF_BACSU -
24 PsiBlast_CBE 97.0999%-116 - C1 -2GGE - YITF_BACSU -
25 PsiBlast_CBE 96.9399%-116 - C1 -2GGE - YITF_BACSU -
22 PsiBlast_CBE 95.2399%-109 - C1 -2GGE - YITF_BACSU -
23 PsiBlast_CBE 94.7999%-114 - C1 -2GGE - YITF_BACSU -
28 HHSearch 89.5594%-112 - C1 -2GDQ - YITF_BACSU -
3 PsiBlast_PDB 54.8031%-115 - C1 -4GGB - GCI_AGRFC -
4 PsiBlast_PDB 50.7131% -94 - C1 -4HPN - GCI_AGRFC -
16 PsiBlast_PDB 48.0724%-101 - C1 -3OP2 1.8 ?
5 PsiBlast_PDB 47.2925% -99 - C1 -3BJS - ? -
33 HHSearch 47.0619%-102 - C1 -2PGW - ? -
13 PsiBlast_PDB 46.9624% -97 - C1 -3OZY 3.8 ?
30 HHSearch 46.0921%-102 * C1 *2CHR - TFDD1_CUPPJ -
46 HHSearch 45.9422%-101 - C1 -4H83 - ? -
12 PsiBlast_PDB 45.9124% -98 - C1 -3OZM - ? -
38 HHSearch 44.9221% -99 - C1 -1NU5 - TCBD_PSESQ -