@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu14480: (2016-06-22 )
MKSIGVVRKVDELGRIVMPIELRRALDIAIKDSIEFFVDGDKIILKKYKPHGVCLMTGEITSENKEYGNGKITLSPEGAQLLLEEIQAALKE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_E_1(2K1N)
ABRB_BACSU
[Raw transfer]

-

CHAIN_E_1(2K1N)
ABRB_BACSU
[Raw transfer]

-

CHAIN_E_1(2K1N)
ABRB_BACSU
[Raw transfer]

-

1 PsiBlast_PDB 70.32100%-129 - C3 -2FY9 - ABH_BACSU -
18 Fugue 68.98100%-134 - C3 -2RO3 - ABH_BACSU -
2 PsiBlast_PDB 68.98100%-134 - C3 -2RO3 - ABH_BACSU -
3 PsiBlast_PDB 66.8370% 0 - C- -2K1N - ABRB_BACSU -
15 PsiBlast_CBE 65.1070%-164 - C3 -2K1N 4.9 ABRB_BACSU
8 PsiBlast_PDB 65.0545%-138 - C3 -2W1T - SP5T_BACSU -
5 PsiBlast_PDB 64.4172%-140 - C3 -2RO4 - ABRB_BACSU -
4 PsiBlast_PDB 63.2372%-187 - C3 -1Z0R - ABRB_BACSU -
6 PsiBlast_PDB 62.6972%-174 - C3 -1YFB - ABRB_BACSU -
28 HHSearch 61.9573%-184 - C3 -1YFB - ABRB_BACSU -
7 PsiBlast_PDB 61.3972%-168 - C3 -1YSF - ABRB_BACSU -
16 PsiBlast_CBE 61.1470% -98 - C3 -2K1N 4.8 ABRB_BACSU
31 HHSearch 59.6453%-170 - C3 -2W1T - SP5T_BACSU -
9 PsiBlast_PDB 53.4754%-122 - C3 -2RO5 - SP5T_BACSU -
17 PsiBlast_CBE 53.3570% -50 - C3 -2K1N 5.6 ABRB_BACSU
25 Fugue 50.3016% -88 - C3 -1A8Y - ? -
39 HHSearch 49.8319%-212 * C3 *1N0E - MRAZ_MYCPN -
33 HHSearch 48.2219%-203 - C3 -1MVF - MAZE_ECOLI -
36 HHSearch 46.1222%-207 - C3 -1N0E - MRAZ_MYCPN -
30 HHSearch 46.1020%-157 - C3 -2MRN - MAZE_ECOLI -