@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu19620: (2016-07-01 )
MKKSGKWFSLAAALSVTAIVGAGCSMSNGDAQKDTKTTAETKQTEQKTADSKKSNTQNSEFSLESQYFNDIKKVDGLETIQNPENILALVNKQYALPGNYEPSDLVIPDVEFSFEEKIQKRYIRKEAADALKTMFDAAKKEGYELAAVSGYRSYDRQKVIFDNEVSLKGERKAKEAVAYPGESEHQTGLAMDISSRSNGFELNEAFGSTADGKWVQDNAYKYGFIIRYPKNKEDITKYEYEPWHLRYVGKKAAKVIQDNDLTLEEYFEKVKKI

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LY0_B_10(4MUS)
?
[Raw transfer]




2D8_A_4(4MUS)
?
[Raw transfer]




LY0_A_3(4MUQ)
?
[Raw transfer]




LY0_A_3(4MUQ)
?
[Raw transfer]




GOL_B_6(4NT9)
?
[Raw transfer]




GOL_B_6(4NT9)
?
[Raw transfer]




DAL_A_8(4OX5)
?
[Raw transfer]




DAL_B_16(4OAK)
?
[Raw transfer]




CHAIN_H_6(4OXD)
?
[Raw transfer]

-

DAL_B_8(4MUT)
?
[Raw transfer]




DAL_A_5(4OAK)
?
[Raw transfer]




DAL_A_4(4MUT)
?
[Raw transfer]




DAL_A_4(4OAK)
?
[Raw transfer]




1 PsiBlast_PDB 82.02100% -50 - C8 -4OX3 - YODJ_BACSU -
38 HHSearch 78.68100% -51 - C8 -4OX3 - YODJ_BACSU -
2 PsiBlast_PDB 63.9855% -67 - C8 -4JID - ? -
3 PsiBlast_PDB 63.2055% -63 - C8 -4MPH - ? -
41 HHSearch 62.6453% -59 - C8 -4MPH - ? -
21 PsiBlast_CBE 61.9855% -65 - C8 -4MPH - ? -
43 HHSearch 53.2338% -2 * C8 *5HNM - ? -
7 PsiBlast_PDB 53.1235% -21 - C8 -4MUT 2.1 ?
42 HHSearch 53.1136% -8 - C8 -4MUQ 4.7 ?
9 PsiBlast_PDB 52.7835% -21 - C8 -4OAK 3.0 ?
30 PsiBlast_CBE 52.4935% -20 - C8 -4MUR - ? -
8 PsiBlast_PDB 52.3035% -21 - C8 -4MUS 4.1 ?
29 PsiBlast_CBE 52.2435% -22 - C8 -4MUS 4.7 ?
27 PsiBlast_CBE 52.2435% -15 - C8 -4OAK 2.5 ?
28 PsiBlast_CBE 52.2135% -22 - C8 -4MUT 2.4 ?
6 PsiBlast_PDB 51.9935% -20 - C8 -4MUR - ? -
39 HHSearch 51.7634% -19 - C8 -4MUR - ? -
32 PsiBlast_CBE 49.1033% 7 - C8 -4NT9 - ? -
26 PsiBlast_CBE 49.1037% 57 - C8 -5HNM - ? -
40 HHSearch 48.9236% 14 - C8 -4NT9 2.8 ?
12 PsiBlast_PDB 47.8333% 6 - C8 -4NT9 2.9 ?
5 PsiBlast_PDB 47.2134% 63 - C8 -4MUQ 4.5 ?
11 PsiBlast_PDB 46.3633% 15 - C8 -4OX5 4.2 ?
13 PsiBlast_PDB 45.8233% 25 - C8 -4OXD 1.4 ?