@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu24890: (2016-07-09 )
MKSQLRKKTLEALSALSNEDILQKTERMYKYLFSLPEWQNAGTIAVTISRGLEIPTRPVIEQAWEEGKQVCIPKCHPDTKKMQFRTYQTDDQLETVYAGLLEPVIEKTKEVNPSQIDLMIVPGVCFDVNGFRVGFGGGYYDRYLSEYEGKTVSLLLECQLFAHVPRLPHDIPVHKLITEDRIISCFS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_3(2JCB)
?
[Raw transfer]




ADP_B_6(2JCB)
?
[Raw transfer]




ADP_A_3(2JCB)
?
[Raw transfer]




24 HHSearch 86.26100%-129 - C7 -1YDM - YQGN_BACSU -
1 PsiBlast_PDB 85.8598%-129 - C7 -1YDM - YQGN_BACSU -
25 HHSearch 71.4446% -97 - C7 -2JCB 6.0 ?
2 PsiBlast_PDB 70.0247% -95 - C7 -2JCB 6.0 ?
21 PsiBlast_CBE 69.0747%-100 - C7 -2JCB 6.1 ?
26 HHSearch 64.0934%-106 - C7 -1SOU - ? -
3 PsiBlast_PDB 63.5034%-106 - C7 -1SOU - ? -
40 Fugue 62.2433% -15 * C7 *1SOU - ? -
27 HHSearch 60.4627% -78 - C7 -3HY3 - MTHFS_HUMAN -
5 PsiBlast_PDB 59.3926% -67 - C7 -3HY3 - MTHFS_HUMAN -
7 PsiBlast_PDB 58.3126% -55 - C7 -3HY6 - MTHFS_HUMAN -
4 PsiBlast_PDB 57.9926% -68 - C7 -3HXT - MTHFS_HUMAN -
6 PsiBlast_PDB 57.5426% -66 - C7 -3HY4 - MTHFS_HUMAN -
28 HHSearch 53.3128%-134 - C7 -1WKC - ? -
29 HHSearch 49.2725% -36 - C7 -1SBQ - MTHFS_MYCPN -
45 Fugue 38.6617% 10 - C6 -2VQ2 - ? -
31 HHSearch 37.5131%-602 - C2 -4MBE - NUP1_YEAST -
49 Fugue 29.5322% 42 - C9 -4DQJ - ? -
13 PsiBlast_PDB 29.1725% 37 - C8 -3N51 - ? -
16 PsiBlast_PDB 28.8325% 39 - C8 -3T3U - ? -