@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27440: (2016-07-13 )
MKKIFSLALISLFAVILLAACGSKGSNGEASKESKKDTLAAIKDNDKIVFGVKTDTRLFGLKNPSSGEIEGFDIDIAKQIAKDILGDEKKAQFKEVTSKTRIPMLQNGDIDAIVATMTITEERKKEVDFSDVYFEAGQSLLVKKGSKIKSVENLGKGSKVLAVKGSTSSQNIREKAPEASVLEFENYAEAFTALKSGQGDALTTDNAILYGMADENKNYQLTGKPFTDEPYGIAVKKGQSALAKEINASLKKMKSDGRYDEIYKKWIKEDPAE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_A_2(4ZV1)
?
[Raw transfer]




GGL_B_5(5EYF)
?
[Raw transfer]




GLN_A_2(4ZV2)
?
[Raw transfer]




GGL_A_3(5EYF)
?
[Raw transfer]




1 PsiBlast_PDB 96.5562% -82 - C1 -5EYF 4.7 ?
21 PsiBlast_CBE 94.8862% -78 - C1 -5EYF 4.8 ?
59 HHSearch 91.1363% -23 - C1 -5EYF - ? -
5 PsiBlast_PDB 77.1934% -51 - C1 -2YJP - ? -
27 PsiBlast_CBE 76.7731% -50 - C1 -1XT8 - ? -
24 PsiBlast_CBE 76.7234% -52 - C1 -2YJP - ? -
23 PsiBlast_CBE 76.4534% -53 - C1 -2YJP - ? -
57 HHSearch 75.7934% -54 - C1 -2YJP - ? -
11 PsiBlast_PDB 75.2831% -49 - C1 -1XT8 - ? -
58 HHSearch 67.9636% -29 - C1 -2V25 - PEB1A_CAMJE -
2 PsiBlast_PDB 67.4151% 35 - C1 -4ZV1 4.1 ?
69 HHSearch 66.2528% -35 - C1 -2Y7I - ? -
22 PsiBlast_CBE 66.0836% -25 - C1 -2V25 - PEB1A_CAMJE -
4 PsiBlast_PDB 65.9536% -27 - C1 -2V25 - PEB1A_CAMJE -
66 HHSearch 64.7130% 27 - C1 -1XT8 - ? -
61 HHSearch 63.7026% -42 - C1 -3KZG - ? -
3 PsiBlast_PDB 63.4451% 40 - C1 -4ZV2 3.8 ?
39 PsiBlast_CBE 63.3931% -46 - C1 -2PYY - ? -
18 PsiBlast_PDB 63.0629% -31 - C1 -2Y7I - ? -
41 PsiBlast_CBE 62.4031% -43 - C1 -2PYY - ? -