@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu27520: (2016-07-13 )
MKISTKGRYGLTIMIELAKKHGEGPTSLKSIAQTNNLSEHYLEQLVSPLRNAGLVKSIRGAYGGYVLGSEPDAITAGDIIRVLEGPISPVEVLEDEEPAKRELWIRIRDAVKEVLDSTTLEDLASYTDGEQEAYMFYI

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_Q_3(4CIC)
?
[Raw transfer]

-

CHAIN_Q_3(4CIC)
?
[Raw transfer]

-

CHAIN_Q_3(4CIC)
?
[Raw transfer]

-

23 PsiBlast_CBE 93.7699%-135 - C2 -2Y75 - CYMR_BACSU -
25 PsiBlast_CBE 92.9399%-135 - C2 -2Y75 - CYMR_BACSU -
24 PsiBlast_CBE 92.2099%-136 - C2 -2Y75 - CYMR_BACSU -
21 PsiBlast_CBE 91.5599%-133 - C2 -2Y75 - CYMR_BACSU -
1 PsiBlast_PDB 90.6699%-137 - C2 -2Y75 - CYMR_BACSU -
22 PsiBlast_CBE 90.5099%-133 - C2 -2Y75 - CYMR_BACSU -
43 HHSearch 89.9599%-137 - C2 -2Y75 - CYMR_BACSU -
37 HHSearch 85.7369%-137 - C2 -3LWF - ? -
2 PsiBlast_PDB 85.3169%-131 - C2 -3LWF - ? -
4 PsiBlast_PDB 79.6565%-135 - C2 -3T8T - ? -
39 HHSearch 77.8267%-124 - C2 -3T8R - ? -
3 PsiBlast_PDB 77.6965%-124 - C2 -3T8R - ? -
38 HHSearch 77.1153%-124 - C2 -4CIC 3.6 ?
5 PsiBlast_PDB 75.1250%-113 - C2 -4CIC 3.6 ?
26 PsiBlast_CBE 73.5650%-114 - C2 -4CIC 2.9 ?
40 HHSearch 69.8233%-140 - C2 -4HF0 - ISCR_ECOLI -
41 HHSearch 69.2733%-157 - C2 -4HF1 - ISCR_ECOLI -
9 PsiBlast_PDB 69.1531%-149 - C2 -4CHU - ? -
7 PsiBlast_PDB 66.7032%-115 - C2 -4HF1 - ISCR_ECOLI -
6 PsiBlast_PDB 66.2831%-124 - C2 -4HF0 - ISCR_ECOLI -