@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu28410: (2016-07-15 )
MKEKEFQSKPLLTKREREVFELLVQDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVELLRMGELEL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_13(1FSE)
GERE_BACSU
[Raw transfer]
33 PsiBlast_CBE 92.39100%-131 - C1 -1FSE - GERE_BACSU -
35 PsiBlast_CBE 89.35100%-125 - C1 -1FSE 3.2 GERE_BACSU
34 PsiBlast_CBE 89.07100%-123 - C1 -1FSE - GERE_BACSU -
70 HHSearch 88.21100%-110 - C1 -1FSE - GERE_BACSU -
11 PsiBlast_PDB 88.21100%-110 - C1 -1FSE - GERE_BACSU -
1 Fugue 88.21100%-110 - C1 -1FSE - GERE_BACSU -
32 PsiBlast_CBE 87.18100%-111 - C1 -1FSE - GERE_BACSU -
3 Fugue 81.9095%-108 - C1 -1FSE - GERE_BACSU -
80 HHSearch 71.7744%-136 * C1 *4WSZ - ? -
31 PsiBlast_CBE 67.12100%-159 - C1 -1FSE - GERE_BACSU -
65 HHSearch 66.7035%-121 - C1 -3QP6 - ? -
39 PsiBlast_CBE 66.5747%-167 - C1 -4WSZ - ? -
16 PsiBlast_PDB 66.4347%-141 - C1 -4WSZ - ? -
15 PsiBlast_PDB 66.3747%-131 - C1 -4WUL - ? -
36 PsiBlast_CBE 66.0647%-159 - C1 -4WUH - ? -
38 PsiBlast_CBE 65.6947%-163 - C1 -4WT0 - ? -
37 PsiBlast_CBE 65.3047%-143 - C1 -4WU4 - ? -
73 HHSearch 64.8538%-133 - C1 -4GVP - VRAR_STAAM -
14 PsiBlast_PDB 64.2147%-126 - C1 -4WUH - ? -
50 PsiBlast_CBE 64.0841%-155 - C1 -3QP5 - ? -