@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu33970: (2016-07-27 )
MLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVASRSAKSALHSNKTIGVLTTYISDYIFPSIIRGIESYLSEQGYSMLLTSTNNNPDNERRGLENLLSQHIDGLIVEPTKSALQTPNIGYYLNLEKNGIPFAMINASYAELAAPSFTLDDVKGGMMAAEHLLSLGHTHMMGIFKADDTQGVKRMNGFIQAHRERELFPSPDMIVTFTTEEKESKLLEKVKATLEKNSKHMPTAILCYNDEIALKVIDMLREMDLKVPEDMSIVGYDDSHFAQISEVKLTSVKHPKSVLGKAAAKYVIDCLEHKKPKQEDVIFEPELIIRQSARKLNE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARB_A_3(3TB6)
ARAR_BACSU
[Raw transfer]




ARB_A_3(3TB6)
ARAR_BACSU
[Raw transfer]




ARB_B_5(3TB6)
ARAR_BACSU
[Raw transfer]




1 PsiBlast_PDB 87.21100%-102 - C2 -3TB6 3.7 ARAR_BACSU
21 PsiBlast_CBE 85.65100%-102 - C2 -3TB6 3.8 ARAR_BACSU
85 HHSearch 77.3995% -27 - C2 -3TB6 3.7 ARAR_BACSU
15 PsiBlast_PDB 53.2927% -5 - C2 -1VPW - PURR_ECOLI -
17 PsiBlast_PDB 53.1327% -5 - C2 -2PUF - PURR_ECOLI -
12 PsiBlast_PDB 53.0726% -4 - C2 -1QQB - PURR_ECOLI -
18 PsiBlast_PDB 52.9427% -2 - C2 -2PUG - PURR_ECOLI -
10 PsiBlast_PDB 52.6326% -2 - C2 -1QP7 - PURR_ECOLI -
8 PsiBlast_PDB 52.5627% 5 - C2 -1JFT - PURR_ECOLI -
11 PsiBlast_PDB 52.2626% -2 - C2 -1QQA - PURR_ECOLI -
9 PsiBlast_PDB 52.2426% -3 - C2 -1BDH - PURR_ECOLI -
66 HHSearch 52.0419% -65 - C2 -2O20 - ? -
20 PsiBlast_PDB 51.8727% 2 - C2 -2PUB - PURR_ECOLI -
16 PsiBlast_PDB 51.8327% -0 - C2 -2PUE - PURR_ECOLI -
19 PsiBlast_PDB 51.7327% -3 - C2 -2PUA - PURR_ECOLI -
7 PsiBlast_PDB 51.0529% -53 - C2 -4RK1 - ? -
74 HHSearch 50.8820% -55 - C2 -3H5O - ? -
76 HHSearch 50.4322% -59 - C2 -3CTP - ? -
75 HHSearch 49.9825% 33 - C2 -1QPZ - PURR_ECOLI -
87 HHSearch 49.3127% -37 - C2 -4RK0 - ? -