@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv3214: (2016-05-17 )
MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVTGLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQLPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGHPQPIAAG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2FP_A_3(3LL4)
SHB17_YEAST
[Raw transfer]




GOL_F_6(2A6P)
?
[Raw transfer]




GOL_E_5(2A6P)
?
[Raw transfer]




GOL_E_5(2A6P)
?
[Raw transfer]




EDO_A_5(4EMB)
GPMA_BORBU
[Raw transfer]




21 PsiBlast_CBE 98.24100%-106 - C2 -2A6P 2.2 ?
113 HHSearch 97.66100%-106 - C2 -2A6P 2.2 ?
1 PsiBlast_PDB 97.66100%-106 - C2 -2A6P 2.2 ?
14 PsiBlast_PDB 64.7129% -85 - C2 -1EBB - ? -
13 PsiBlast_PDB 64.6228% -84 - C2 -1H2F - ? -
12 PsiBlast_PDB 64.6128% -83 * C2 *1H2E - ? -
6 PsiBlast_PDB 63.3327% -92 - C2 -4IJ5 - PSPA_HYDTT -
120 HHSearch 63.1924% -79 - C2 -4EMB 3.5 GPMA_BORBU
117 HHSearch 63.1028% -73 - C2 -1H2E - ? -
114 HHSearch 63.0026% -77 - C2 -4IJ5 - PSPA_HYDTT -
123 HHSearch 62.9922% -75 - C2 -1QHF - PMG1_YEAST -
115 HHSearch 62.8231% -73 - C2 -4PZA - GPGP_MYCTO -
105 Fugue 62.0223% -78 - C2 -1QHF - PMG1_YEAST -
116 HHSearch 61.4726% -79 - C2 -3E9C - TIGRB_DANRE -
136 HHSearch 61.2128% -70 - C2 -4EO9 - GPMA_MYCLB -
126 HHSearch 60.5723% -76 - C2 -3KKK - ? -
121 HHSearch 60.5320% -62 - C2 -3R7A - ? -
124 HHSearch 60.4022% -65 - C2 -3DCY - TIGAR_HUMAN -
103 Fugue 58.9827% -72 - C2 -3F3K - SHB17_YEAST -
134 HHSearch 58.9632% -56 - C2 -3F3K - SHB17_YEAST -