@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA5500: (2016-03-08 )
MDNALVRLTQVGVSFNGQAVLSDVDLAIEPGQIVTLIGPNGAGKTTLVRSVLGLLKPHVGEVWRRPRLTIGYMPQKLHVDATLPLSVLRFLRLVPGVKREQALAALREVGAAHVLERPLQSISGGELQRVLLARALLRKPELLVLDEPVQGVDVAGQAELYRLIGKLRDRYGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELFGQDARSLAIYHHHHDHAHDLHGEVVKAGPGALPPGTRFTPVHKHGPDCNHG

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_C_11(4HLU)
ECFA1_THEMA
[Raw transfer]




GOL_A_5(4P33)
LPTB_ECOLI
[Raw transfer]




7 PsiBlast_PDB 88.9330%-143 - C1 -4G1U - HMUV_YERPE -
2 PsiBlast_PDB 85.0831%-130 - C1 -4QC2 - ? -
1 PsiBlast_PDB 84.7031%-133 - C1 -4P32 - LPTB_ECOLI -
23 PsiBlast_CBE 84.5631%-129 - C1 -4P33 2.7 LPTB_ECOLI
4 PsiBlast_PDB 84.2331%-131 - C1 -4P33 - LPTB_ECOLI -
22 PsiBlast_CBE 83.4331%-130 - C1 -4QC2 - ? -
21 PsiBlast_CBE 82.4031%-130 - C1 -4P32 - LPTB_ECOLI -
6 PsiBlast_PDB 80.8631%-135 - C1 -4WBS - ? -
38 HHSearch 80.4630%-141 - C1 -1OXX - ? -
17 PsiBlast_PDB 80.3324%-153 - C1 -1G6H - LIVG_METJA -
49 HHSearch 78.8327%-142 - C1 -2OLJ - ? -
51 HHSearch 78.5029%-136 - C1 -1B0U - HISP_SALTY -
24 PsiBlast_CBE 76.7231%-135 - C1 -4WBS - ? -
60 Fugue 75.6225%-120 - C1 -1Z47 - ? -
36 HHSearch 74.7829%-150 - C1 -3RLF - MALK_ECOLI -
37 HHSearch 73.5826%-146 - C1 -2YYZ - ? -
39 HHSearch 73.1227%-142 * C1 *3TUI - METN_ECOLI -
25 PsiBlast_CBE 72.4232%-133 - C1 -1Z47 - ? -
11 PsiBlast_PDB 71.8829%-138 - C1 -1OXU - ? -
32 HHSearch 71.3128%-148 - C1 -1Z47 - ? -
26 PsiBlast_CBE 57.9231%-134 - C1 -4HLU 5.5 ECFA1_THEMA