@TOME V3
(Feb 2022)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I2JNQ5_9GAMM: (2019-01-29 )
MTMPQANIIPNDWWRWSDSQPVIIKPLLGGLTNLNYLISVNHELFVLRKNSAISEALNLNRSAEAKALSRADEAGLCAPLIYYDDQHQYMVSRYLGDKTWSVSIDHNLSLLAELLRGIHQLPGIDADLNVENKISCYWQAIDAQAAFTRELISLDSAVGAHITSAKALNNGHVLCHNDLLASNLIISNKDKLYAIDWEYAAMSDPFYELAVIIEGNALNAKQQQSLLTRYLRQPISALDWQRLYHWQIIYGYLCVLWYAVQYSNGAMPNIVSEIHRQILAIKALAAKDA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PT3_A_6(3MES)
?
[Raw transfer]




2 PsiBlast_PDB 81.9325% -6 - C3 -4R7B - ? -
1 PsiBlast_PDB 78.8225% -4 - C3 -4R78 - ? -
62 HHSearch 76.6922% -18 * C3 *4R7B - ? -
61 HHSearch 73.9822% -19 - C3 -4R78 - ? -
92 Fugue 68.2116% -39 - C3 -1NW1 - CKA2_CAEEL -
57 HHSearch 64.0617% -6 - C3 -2QG7 - ? -
81 SP3 62.9215% -44 - C3 -1NW1 - CKA2_CAEEL -
68 HHSearch 62.6913% -48 - C3 -3MES 3.3 ?
64 HHSearch 62.0216% -29 - C3 -1NW1 - CKA2_CAEEL -
58 HHSearch 61.7017% -3 - C3 -2QG7 - ? -
63 HHSearch 61.6016% -30 - C3 -1NW1 - CKA2_CAEEL -
70 HHSearch 61.4617% -19 - C3 -5FUT - CHKA_HUMAN -
71 HHSearch 60.9817% -3 - C3 -5FTG - CHKA_HUMAN -
67 HHSearch 60.8613% -49 - C3 -3MES - ? -
91 Fugue 59.8014% -29 - C3 -2QG7 - ? -
60 HHSearch 59.5322% -15 - C3 -3DXQ - ? -
95 Fugue 56.6915% -25 - C3 -2OLC - MTNK_BACSU -
66 HHSearch 55.5015% -29 - C3 -3C5I - ? -
94 Fugue 55.0614% -28 - C3 -2PPQ - KHSE_AGRFC -
79 HHSearch 54.6213% -57 - C3 -6EF6 - ? -