@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : I3TZW1: (2017-12-17 )
MEFLKEIIHNSWQEVLSSEFSKDYYLHLREFLKKEYASQKIHPDMYHIYEALELTPYEEVKVVILGQDPYHGENQAHGLSFSVQPGVKIPPSLRNIYKELYDDLGIAPVQHGNLVSWAKQGVLLLNTVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMIDKSRHIIITSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLPETV

Atome Classification :

(53 SA) .........10........20........30......-..-40.-.......50........60........70........80.....-...-90.....---.---..100..-.-....110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......
(Atome) (Ident) (Tito) (Num) (QMean) (Ligand) (Uniprot) MEFLKEIIHNSWQEVLSSEFSKDYYLHLREFLKKEYA-SQ-KIH-PDMYHIYEALELTPYEEVKVVILGQDPYHGENQAHGLSFSVQPG-VKI-PPSLRNI---Y---KELYDDL-G-IAPVQHGNLVSWAKQGVLLLNTVLTVREGQAYSHRGKGWERLTDTIIEKLNEREKPIVFILWGKPAQEKIKMIDKSRHIIITSPHPSPLSASRGFFGSKPFSKTNDALLALGEEPIDWQLPETV
74 HHSearch 97.4563%-102 - C8 - - 3ZOQ UNG_BACSU A:[3-224] -----QLLQDSWWNQLKEEFEKPYYQELREMLKREYA-EQ-TIY-PDSRDIFNALHYTSYDDVKVVILGQDPYHGPGQAQGLSFSVKPG-VKQ-PPSLKNI---F---LELQQDI-G-CSIPNHGSLVSWAKQGVLLLNTVLTVRRGQANSHKGKGWERLTDRIIDVLSERERPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPFSARNGFFGSRPFSRANAYLEKMGEAPIDWCIKD--
75 HHSearch 97.2063%-100 - C8 - - 3ZOR - UNG_BACSU A:[3-224] -----QLLQDSWWNQLKEEFEKPYYQELREMLKREYA-EQ-TIY-PDSRDIFNALHYTSYDDVKVVILGQDPYHGPGQAQGLSFSVKPG-VKQ-PPSLKNI---F---LELQQDI-G-CSIPNHGSLVSWAKQGVLLLNTVLTVRRGQANSHKGKGWERLTDRIIDVLSERERPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPFSARNGFFGSRPFSRANAYLEKMGEAPIDWCIKD--
1 PsiBlast_PDB 97.0862%-102 - C8 - - 3ZOQ UNG_BACSU A:[3-224] -----QLLQDSWWNQLKEEFEKPYYQELREMLKREYA-EQ-TIY-PDSRDIFNALHYTSYDDVKVVILGQDPYHGPGQAQGLSFSVKPG-VKQ-PPSLKNI---F---LELQQDI-G-CSIPNHGSLVSWAKQGVLLLNTVLTVRRGQANSHKGKGWERLTDRIIDVLSERERPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPFSARNGFFGSRPFSRANAYLEKMGEAPIDWCIKD--
2 PsiBlast_PDB 96.8362%-100 - C8 - - 3ZOR - UNG_BACSU A:[3-224] -----QLLQDSWWNQLKEEFEKPYYQELREMLKREYA-EQ-TIY-PDSRDIFNALHYTSYDDVKVVILGQDPYHGPGQAQGLSFSVKPG-VKQ-PPSLKNI---F---LELQQDI-G-CSIPNHGSLVSWAKQGVLLLNTVLTVRRGQANSHKGKGWERLTDRIIDVLSERERPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPFSARNGFFGSRPFSRANAYLEKMGEAPIDWCIKD--
4 PsiBlast_PDB 88.4357% -99 - C8 - - 3WDG - UNG_STAAR A:[3-216] -----------WSQIFHDITTKHDFKAMHDFLEKEYS-TA-IVY-PDRENIYQAFDLTPFENIKVVILGQDPYHGPNQAHGLAFSVQPN-AKF-PPSLRNM---Y---KELADDI-G-CV-RQTPHLQDWAREGVLLLNTVLTVRQGEANSHRDIGWETFTDEIIKAVSDYKEHVVFILWGKPAQQKIKLIDTSKHCIIKSVHPSPLSAYRGFFGSKPYSKANTYLESVGKSPINWCES---
5 PsiBlast_PDB 85.0458% -25 - C8 - - 2BOO - UNG_DEIRA A:[27-244] -----------WQEALLPEFSAPYFHELTDFLRQERK-EY-TIY-PPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPG-VRV-PPSLRNI---Y---KELTEDIPG-FVAPKHGYLRSWAEQGVLLLNAVLTVRAGQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKKKKLITGKNHVVIESGHPSPLS-EQYFFGTRPFSKTNEALEKAGRGPVEWQLPATV
79 HHSearch 84.9257% -26 - C8 - - 2BOO - UNG_DEIRA A:[19-243] ---IPANLPEDWQEALLPEFSAPYFHELTDFLRQERK-EY-TIY-PPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPG-VRV-PPSLRNI---Y---KELTEDIPG-FVAPKHGYLRSWAEQGVLLLNAVLTVRAGQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKKKKLITGKNHVVIESGHPSPLSE-QYFFGTRPFSKTNEALEKAGRGPVEWQLPAT-
6 PsiBlast_PDB 83.7358% -28 - C8 - - 3UFM - UNG_DEIRA A:[27-244] -----------WQEALLPEFSAPYFHELTDFLRQERK-EY-TIY-PPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPG-VRV-PPSLRNI---Y---KELTEDIPG-FVAPKHGYLRSWAEQGVLLLNAVLTVRAGQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKKKKLITGKNHVVIESGHPSPLS-EQYFFGTRPFSKTNEALEKAGRGPVEWQLPATV
80 HHSearch 82.0556% -22 - C8 - - 4UQM UNG_DEIRA A:[19-243] ---IPANLPEDWQEALLPEFSAPYFHELTDFLRQERK-EY-TIY-PPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPG-VRV-PPSLRNI---Y---KELTEDIPG-FVAPKHGYLRSWAEQGVLLLNAVLTVRAAQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKKKKLITGKNHVVIESGHPSPLSE-QYFFGTRPFSKTNEALEKAGRGPVEWQLPAT-
7 PsiBlast_PDB 82.0157% -23 - C8 - - 4UQM UNG_DEIRA A:[27-244] -----------WQEALLPEFSAPYFHELTDFLRQERK-EY-TIY-PPAPDVFNALRYTPLGEVKVLILGQDPYHGPNQAHGLSFSVRPG-VRV-PPSLRNI---Y---KELTEDIPG-FVAPKHGYLRSWAEQGVLLLNAVLTVRAAQANSHQGKGWEHFTDAVIKAVNAKEERVVFILWGSYARKKKKLITGKNHVVIESGHPSPLS-EQYFFGTRPFSKTNEALEKAGRGPVEWQLPATV
30 PsiBlast_CBE 81.3650% -30 - C8 - - 1OKB ? A:[1-221] MEFFGE----TWRRELAAEFEKPYFKQLMSFVADERS-RH-TVY-PPADQVYSWTEMCDIQDVKVVILGQDPYHGPNQAHGLCFSVQKP-VPP-PPSLVNI---Y---KELCTDIDG-FKHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKDRGWETFTDAVIKWLSVNREGVVFLLWGSYAHKKGATIDRKRHHVLQAVHPSPLSAHRGFLGCKHFSKANGLLKLSGTEPINWR-----
23 PsiBlast_CBE 81.2850% -30 - C8 - - 3FCK UNG_HUMAN B:[2-221] -EFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
29 PsiBlast_CBE 81.1650% -30 - C8 - - 1OKB ? B:[1-221] MEFFGE----TWRRELAAEFEKPYFKQLMSFVADERS-RH-TVY-PPADQVYSWTEMCDIQDVKVVILGQDPYHGPNQAHGLCFSVQKP-VPP-PPSLVNI---Y---KELCTDIDG-FKHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKDRGWETFTDAVIKWLSVNREGVVFLLWGSYAHKKGATIDRKRHHVLQAVHPSPLSAHRGFLGCKHFSKANGLLKLSGTEPINWR-----
17 PsiBlast_PDB 80.7850% -29 - C8 - - 1AKZ - UNG_HUMAN A:[82-302] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
76 HHSearch 80.7450% -28 * C8 * - 3FCI UNG_HUMAN A:[2-222] -----EFFGESWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKE----
24 PsiBlast_CBE 80.7050% -25 - C8 - - 3FCI UNG_HUMAN A:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
22 PsiBlast_CBE 80.3850% -27 - C8 - - 3FCL UNG_HUMAN A:[2-221] -EFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
27 PsiBlast_CBE 80.2750% -23 - C8 - - 2SSP UNG_HUMAN E:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPASVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
12 PsiBlast_PDB 79.9750% -27 - C8 - - 1SSP UNG_HUMAN E:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
10 PsiBlast_PDB 79.9551% -26 - C8 - - 3TKB UNG_HUMAN A:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIEG-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWR-----
21 PsiBlast_CBE 79.7250% -25 - C8 - - 3FCL UNG_HUMAN B:[2-221] -EFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
16 PsiBlast_PDB 79.2350% -21 - C8 - - 2HXM UNG_HUMAN A:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
13 PsiBlast_PDB 79.0750% -23 - C8 - - 1EMH UNG_HUMAN A:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
20 PsiBlast_PDB 78.9150% -23 - C8 - - 3FCF UNG_HUMAN A:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
15 PsiBlast_PDB 78.5650% -24 - C8 - - 1Q3F UNG_HUMAN A:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
14 PsiBlast_PDB 78.3750% -24 - C8 - - 1EMJ UNG_HUMAN A:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
77 HHSearch 77.8150% -22 - C8 - - 2OXM UNG_HUMAN A:[2-222] -----EFFGESWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKE----
18 PsiBlast_PDB 77.2250% -18 - C8 - - 2OXM UNG_HUMAN A:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
31 PsiBlast_CBE 76.5349% -22 - C8 - - 4SKN UNG_HUMAN E:[1-221] MEFFGE----SWKKHLSGEFGKPYFIKLMGFVAEERK-HY-TVY-PPPHQVFTWTQMCDIKDVKVVILGQNPYHGPNQAHGLCFSVQRP-VPP-PPSLENI---Y---KELSTDIED-FVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPRSVYRGFFGCRHFSKTNELLQKSGKKPIDWK-----
51 PsiBlast_CBE 74.5646% -11 - C8 - - 4WRU UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
42 PsiBlast_CBE 74.4446% -16 - C8 - - 4WS3 UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
44 PsiBlast_CBE 74.2046% -14 - C8 - - 4WS1 UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
37 PsiBlast_CBE 74.2046% -12 - C8 - - 4WS8 UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
59 PsiBlast_CBE 73.7737% -31 - C8 - - 1UDH UNG_HHV11 A:[27-244] ------LIDDAWRPLMEPELANPLTAHLLAEYNRRCQ-TE-EVL-PPREDVFSWTRYCTPDEVRVVIIGQDPYHHPGQAHGLAFSVRAN-VPP-PPSLRNV---LAAVKNCYPEA-R-MS--GHGCLEKWARDGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARRPGLVFMLWGTHAQNAIRP-DPRVHCVLKFSHPSPLSKV-PFGTCQHFLVANRYLETRSISPIDWSV----
45 PsiBlast_CBE 73.7146% -11 - C8 - - 4WS0 UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
50 PsiBlast_CBE 73.7046% -15 - C8 - - 4WRV UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
49 PsiBlast_CBE 73.6546% -10 - C8 - - 4WRW UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
47 PsiBlast_CBE 73.2246% -7 - C8 - - 4WRY UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
38 PsiBlast_CBE 73.2246% -8 - C8 - - 4WS7 UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
40 PsiBlast_CBE 72.9246% -8 - C8 - - 4WS5 UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
61 PsiBlast_CBE 72.7137% -27 - C8 - - 1LAU UNG_HHV11 E:[27-244] ------LIDDAWRPLMEPELANPLTAHLLAEYNRRCQ-TE-EVL-PPREDVFSWTRYCTPDEVRVVIIGQDPYHHPGQAHGLAFSVRAN-VPP-PPSLRNV---LAAVKNCYPEA-R-MS--GHGCLEKWARDGVLLLNTTLTVKRGAAASHSRIGWDRFVGGVIRRLAARRPGLVFMLWGTHAQNAIRP-DPRVHCVLKFSHPSPLSKV-PFGTCQHFLVANRYLETRSISPIDWSV----
52 PsiBlast_CBE 72.6546% -3 - C8 - - 4WPL UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
46 PsiBlast_CBE 71.8746% -3 - C8 - - 4WRZ UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
53 PsiBlast_CBE 71.6746% -3 - C8 - - 4WPK UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
41 PsiBlast_CBE 71.6246% -3 - C8 - - 4WS4 UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
43 PsiBlast_CBE 71.4746% -3 - C8 - - 4WS2 UNG_MYCTU A:[17-238] ---LSELVERGWAAAL--EPVADQVAHMGQFLRAEIA-AG-RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGHAVGLSFSVAPD-VRPWPRSLANI---F---DEYTADL-G-YPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTECAIRALAARAAPLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSASRGFFGSRPFSRANELLVGMGAEPIDWRLP---
39