@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : E5RJ69_HUMAN: (2017-06-02 )
WLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVN

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_I_3(1BHF)

[Raw transfer]




PHS_B_3(1LCJ)
LCK_HUMAN
[Raw transfer]




PHS_B_4(1LKL)
?
[Raw transfer]




CHAIN_B_2(1CWE)
?
[Raw transfer]

-

CHAIN_P_2(1CWD)
?
[Raw transfer]

-

CHAIN_J_8(1X27)
?
[Raw transfer]

-

CHAIN_B_2(1LKK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_D_4(1CWE)
?
[Raw transfer]

-

CHAIN_B_2(1LCJ)
LCK_HUMAN
[Raw transfer]

-

CHAIN_L_10(1X27)
?
[Raw transfer]

-

CHAIN_K_9(1X27)
?
[Raw transfer]

-

CHAIN_N_12(1X27)
?
[Raw transfer]

-

CHAIN_I_2(1BHF)

[Raw transfer]

-

CHAIN_I_7(1X27)

[Raw transfer]

-

CHAIN_M_11(1X27)
?
[Raw transfer]

-

ACE_B_3(1LKL)
?
[Raw transfer]




CHAIN_B_2(1LKL)
?
[Raw transfer]

-

CHAIN_B_2(1LCK)
LCK_HUMAN
[Raw transfer]

-

CHAIN_B_2(1JU5)
CRK_HUMAN
[Raw transfer]

-

15 PsiBlast_PDB 81.9954% -49 - C1 -3VS5 Calc... HCK_HUMAN
262 HHSearch 81.7852% -29 - C1 -4D8K Calc...
12 PsiBlast_PDB 81.6154% -56 - C1 -3VS2 Calc... HCK_HUMAN
54 PsiBlast_CBE 81.1647% -43 - C1 -1IJR - LCK_HUMAN -
4 PsiBlast_PDB 81.1154% -25 - C1 -1QCF Calc... HCK_HUMAN
18 PsiBlast_PDB 80.9454% -49 - C1 -4LUD Calc... HCK_HUMAN
9 PsiBlast_PDB 80.6154% -44 - C1 -3VRZ Calc... HCK_HUMAN
17 PsiBlast_PDB 80.3854% -13 - C1 -3VS7 Calc... HCK_HUMAN
3 PsiBlast_PDB 80.2254% -26 - C1 -4U5W Calc... HCK_HUMAN
22 PsiBlast_CBE 79.7954% -41 - C1 -4LUE Calc... HCK_HUMAN
104 PsiBlast_CBE 79.5940% -29 - C1 -1O44 - -
72 PsiBlast_CBE 79.5241% -30 - C1 -1IS0 - SRC_RSVSA -
13 PsiBlast_PDB 79.3454% -16 - C1 -3VS3 Calc... HCK_HUMAN
51 PsiBlast_CBE 79.3048% -31 - C1 -4D8K - -
42 PsiBlast_CBE 79.3048% -28 - C1 -1LCJ 4.9 LCK_HUMAN
122 PsiBlast_CBE 79.2740% -26 - C1 -1A07 - SRC_HUMAN -
19 PsiBlast_PDB 78.9454% -33 - C1 -4LUE Calc... HCK_HUMAN
45 PsiBlast_CBE 78.8148% -34 - C1 -1X27 5.2 ?
50 PsiBlast_CBE 78.7848% -26 - C1 -1X27 4.2
100 PsiBlast_CBE 77.9940% -31 - C1 -1O48 - -
40 PsiBlast_CBE 77.9348% -32 - C1 -1CWE 6.1 ?
49 PsiBlast_CBE 77.2648% -31 - C1 -1X27 6.2 ?
53 PsiBlast_CBE 77.0548% -18 - C1 -1LKL 3.9 ?
44 PsiBlast_CBE 76.8248% -35 - C1 -1BHF 5.2
52 PsiBlast_CBE 76.7048% -30 - C1 -1LKK 7.6 LCK_HUMAN
41 PsiBlast_CBE 74.9748% -33 - C1 -1CWD 4.5 ?
39 PsiBlast_CBE 74.7348% -44 - C1 -1CWE 5.6 ?
47 PsiBlast_CBE 74.0848% -32 - C1 -1X27 5.8 ?
48 PsiBlast_CBE 72.0448% -16 - C1 -1X27 4.6 ?
43 PsiBlast_CBE 71.8048% -27 - C1 -1LCK 4.2 LCK_HUMAN
46 PsiBlast_CBE 71.3548% -21 - C1 -1X27 5.5 ?
248 HHSearch 65.8435% -53 - C1 -1JU5 3.6 CRK_HUMAN