@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Q53EL3_HUMAN: (2017-06-03 )
WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHY

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACE_I_3(1BHF)

[Raw transfer]




ACE_B_3(1LKK)
LCK_HUMAN
[Raw transfer]




ACE_B_3(1LKL)
?
[Raw transfer]




4 PsiBlast_PDB 93.2698%-218 - C2 -2RSY - CSK_RAT -
319 HHSearch 91.3999%-206 - C2 -1K9A - CSK_RAT -
1 PsiBlast_PDB 91.38100%-206 - C- -3EAC - CSK_HUMAN -
2 PsiBlast_PDB 91.1498%-206 - C2 -1K9A - CSK_RAT -
301 HHSearch 91.1299%-199 - C- -3EAZ - CSK_HUMAN -
3 PsiBlast_PDB 90.8598%-199 - C- -3EAZ - CSK_HUMAN -
306 HHSearch 83.0759%-223 - C2 -3US4 - -
6 PsiBlast_PDB 82.5757%-223 - C2 -3US4 - -
5 PsiBlast_PDB 72.5858%-183 - C2 -1JWO - MATK_HUMAN -
305 HHSearch 61.7442%-107 - C2 -1JU5 - CRK_HUMAN -
14 PsiBlast_PDB 61.3540% -98 - C2 -3K2M - ABL1_HUMAN -
19 PsiBlast_PDB 60.2840%-112 - C2 -5DC0 - ABL1_HUMAN -
20 PsiBlast_PDB 60.0040% -97 - C2 -2ABL - ABL1_HUMAN -
12 PsiBlast_PDB 59.4242%-179 - C2 -2RVF - ? -
15 PsiBlast_PDB 59.0040%-107 - C2 -3T04 - -
18 PsiBlast_PDB 58.2040%-107 - C2 -5DC9 - -
313 HHSearch 57.9440%-131 - C2 -4EIH - -
17 PsiBlast_PDB 57.1640%-105 - C2 -5DC4 - -
317 HHSearch 57.0742%-108 - C2 -2DVJ - CRK_HUMAN -
27 PsiBlast_CBE 56.5940%-103 - C2 -2FO0 - ABL1_HUMAN -
287 PsiBlast_CBE 42.1833% -28 - C2 -1BHF Error
288 PsiBlast_CBE 40.6933% -19 - C2 -1LKK Error LCK_HUMAN
289 PsiBlast_CBE 40.3833% -19 - C2 -1LKL 3.4 ?