@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0921: (2018-01-01 )
MPFVRIDLFEGRTLEQKKALAKEVTEAVVRNTGAPQSAVHVIINDMPEGTYFPQGEMRTK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FHC_A_3(2OPA)
4OT_BACSU
[Raw transfer]
105 Fugue 79.2442%-123 - C1 -1BJP - 4OT1_PSEPU -
8 PsiBlast_PDB 78.8242%-124 - C1 -2FM7 - 4OT1_PSEPU -
4 PsiBlast_PDB 78.7742% 0 - C- -4OTC - 4OT1_PSEPU -
2 PsiBlast_PDB 78.7742% 0 - C- -4OTA - 4OT1_PSEPU -
9 PsiBlast_PDB 78.4346%-142 - C1 -4FAZ - ? -
7 PsiBlast_PDB 78.1947%-166 - C1 -2X4K - Y1376_STAAR -
10 PsiBlast_PDB 77.4340%-165 - C1 -5CLO - 4OT1_PSEPU -
47 PsiBlast_CBE 77.4242%-126 - C1 -1BJP - 4OT1_PSEPU -
6 PsiBlast_PDB 76.9442%-153 - C1 -4X1C - 4OT1_PSEPU -
95 HHSearch 76.3942%-154 - C1 -4X1C - 4OT1_PSEPU -
56 PsiBlast_CBE 76.1040%-167 - C1 -5CLO - 4OT1_PSEPU -
50 PsiBlast_CBE 75.1542%-128 - C1 -1BJP - 4OT1_PSEPU -
57 PsiBlast_CBE 73.9040%-144 - C1 -5CLO - 4OT1_PSEPU -
84 HHSearch 73.8943%-121 * C1 *2X4K - Y1376_STAAR -
94 HHSearch 73.8641%-116 - C1 -4FAZ - ? -
48 PsiBlast_CBE 73.8542%-119 - C1 -1BJP - 4OT1_PSEPU -
55 PsiBlast_CBE 73.1941%-173 - C1 -4X1C - 4OT1_PSEPU -
21 PsiBlast_CBE 73.1342% 0 - C- -4X19 - 4OT1_PSEPU -
5 PsiBlast_PDB 73.1342% 0 - C- -4X19 - 4OT1_PSEPU -
58 PsiBlast_CBE 72.5440%-145 - C1 -5CLO - 4OT1_PSEPU -