@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr0970: (2018-01-02 )
MWVKDMFILGSGDQGLAVLSIYEGEVEGLVDIFEEGRFIGCKILDKTVLGGLKWFESLLLTLDRKPRAIVAFGDNFKREEIFCSYKNKVEYINVICNSARIFKHSFLGKGNFIGTNVTIQALVEIGDNNIINSGSIVSCNCKIGNNVNISPGVILSGNVKIDDNVFIGAGATIRDAVSIGFGAIIGAGATVIHNVPENAVVVGTPGKIIKYRSV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACO_C_7(4M99)
?
[Raw transfer]




COA_A_3(4HZD)
?
[Raw transfer]




COA_A_3(4EAB)
?
[Raw transfer]




163 Fugue 69.2628% -84 - C3 -4EAB - ? -
143 HHSearch 66.3829% -49 - C3 -4EA9 - ? -
144 HHSearch 66.1929% -45 - C3 -4EAA - ? -
145 HHSearch 62.6529% -90 - C3 -2VHE - PGLD_CAMJE -
147 HHSearch 62.0926% -29 - C3 -4M99 - ? -
146 HHSearch 61.8329% -92 - C3 -3BFP - PGLD_CAMJE -
149 HHSearch 61.0026% -44 - C3 -4M9C - ? -
8 PsiBlast_PDB 59.1331% -10 - C3 -3BSY - PGLD_CAMJE -
7 PsiBlast_PDB 59.0731% -20 - C3 -3BSW - PGLD_CAMJE -
167 Fugue 58.9122% -72 - C2 -1KRR - THGA_ECOLI -
23 PsiBlast_CBE 56.6131% -16 - C3 -3BSY - PGLD_CAMJE -
22 PsiBlast_CBE 56.5231% -12 - C3 -3BSY - PGLD_CAMJE -
148 HHSearch 56.4526% -25 - C- -4M98 - ? -
1 PsiBlast_PDB 56.1032% -35 - C3 -4EAB 3.2 ?
10 PsiBlast_PDB 55.7731% -29 - C3 -5TYH - PGLD_CAMJE -
2 PsiBlast_PDB 55.5132% -31 - C3 -4EAA - ? -
6 PsiBlast_PDB 54.8631% -10 - C3 -3BSS - PGLD_CAMJE -
21 PsiBlast_CBE 54.5731% -13 - C3 -5T2Y - PGLD_CAMJE -
9 PsiBlast_PDB 54.4431% -21 - C3 -5T2Y - PGLD_CAMJE -
164 Fugue 54.3427% -45 - C3 -3BFP - PGLD_CAMJE -