@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1175: (2018-01-06 )
MALAKIVFASMTGNTEEIADIVADKLRDLGLDVDVDECTTVDASDFLEADIAIVATYTYGDGELPDEMMDFYEDLADLNLNGKIYGVVGSGDTFYDEFCKAVDDFDRVFVSTGAEKGSECVKVDLSAEEEDIERLEQFAEELAAKVG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_C_6(5LJI)
?
[Raw transfer]




FMN_A_3(5LJI)
?
[Raw transfer]




53 HHSearch 90.75100%-125 - C1 -5LJL - ? -
1 PsiBlast_PDB 90.75100%-125 - C1 -5LJL - ? -
21 PsiBlast_CBE 89.4697%-124 - C1 -5LJI 11.0 ?
2 PsiBlast_PDB 89.3297%-124 - C1 -5LJI 10.9 ?
54 HHSearch 60.7626% -66 - C1 -5B3K - Y3435_PSEAE -
51 HHSearch 60.5126% -74 - C1 -5B3L - Y3435_PSEAE -
61 HHSearch 56.7627% -63 * C1 *3KAQ - FLAW_DESDA -
6 PsiBlast_PDB 56.3133% -36 - C1 -1WSW - FLAV_DESVH -
18 PsiBlast_PDB 55.9333% -34 - C1 -1J9G - FLAV_DESVH -
55 HHSearch 55.3726% -54 - C1 -4OXX - CINC_CITBR -
8 PsiBlast_PDB 55.2033% -41 - C1 -1XYY - FLAV_DESVH -
22 PsiBlast_CBE 54.5332% -32 - C1 -5V56 - ? -
5 PsiBlast_PDB 53.7333% -36 - C1 -1WSB - FLAV_DESVH -
23 PsiBlast_CBE 53.6132% -32 - C1 -5V57 - ? -
24 PsiBlast_CBE 53.5734% -16 - C1 -4HEQ - FLAV_DESGI -
7 PsiBlast_PDB 53.4233% -29 - C1 -1XYV - FLAV_DESVH -
4 PsiBlast_PDB 53.4032% -29 - C1 -5V57 - ? -
3 PsiBlast_PDB 53.1732% -31 - C1 -5V56 - ? -
9 PsiBlast_PDB 52.8934% -14 - C1 -4HEQ - FLAV_DESGI -
13 PsiBlast_PDB 52.8533% -31 - C1 -1J8Q - FLAV_DESVH -