@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : spr1889: (2018-01-22 )
MRKRDRHQLIKKMITEEKLSTQKEIQDRLEAHNVCVTQTTLSRDLREIGLTKVKKNDMVYYVLVNETEKIDLVEFLSHHLEGVARAEFTLVLHTKLGEASVLANIVDVNKDEWILGTVAGANTLLVICRDQHVAKLMEDRLLDLMKDK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ARG_F_11(1B4B)

[Raw transfer]




ARG_F_12(2ZFZ)
ARGR_MYCTU
[Raw transfer]




TYR_A_3(5JVO)
?
[Raw transfer]




1 PsiBlast_PDB 84.5432% -49 - C6 -1F9N - ARGR_BACSU -
3 PsiBlast_PDB 83.8132% -49 - C6 -1B4A - ARGR_GEOSE -
2 PsiBlast_PDB 77.9930% -40 - C6 -5CJ9 - ARGR_BACHD -
7 PsiBlast_PDB 69.7930% -41 - C6 -3LAP - ARGR_MYCTU -
73 HHSearch 69.0930%-227 - C6 -1B4B 2.6
6 PsiBlast_PDB 67.9030% -46 - C6 -3LAJ - ARGR_MYCTU -
5 PsiBlast_PDB 67.4830% -53 - C6 -3FHZ - ARGR_MYCTU -
4 PsiBlast_PDB 66.3330% -13 - C6 -3ERE - ARGR_MYCTU -
98 Fugue 65.8630%-156 * C6 *1B4B - ARGR_GEOSE -
71 HHSearch 64.2127%-195 - C6 -2P5M - ARGR_BACSU -
68 HHSearch 64.1828%-182 - C6 -5JVO 2.4 ?
72 HHSearch 63.9227%-188 - C6 -2P5M - ARGR_BACSU -
37 PsiBlast_CBE 61.3338%-160 - C6 -1B4B - -
67 HHSearch 61.1724% - - C- -3V4G - ARGR_VIBVY -
25 PsiBlast_CBE 60.2532%-134 - C6 -2P5M - ARGR_BACSU -
70 HHSearch 59.9225%-176 - C6 -2ZFZ 3.8 ARGR_MYCTU
69 HHSearch 59.9225%-177 - C6 -3BUE - ARGR_MYCTU -
26 PsiBlast_CBE 59.8132%-119 - C6 -2P5M - ARGR_BACSU -
38 PsiBlast_CBE 59.4638%-156 - C6 -1B4B - ARGR_GEOSE -
16 PsiBlast_PDB 59.2238%-161 - C6 -1B4B - ARGR_GEOSE -