@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VQN9: (2017-11-28 )
MTVAMSIMISTEEIQAKVKELGEQINSHYANSDKELVLIGLLRGSVIFMADLCRTITKPHELDFMTVSSYGGGTTSSRDVKILKDLDGEIRGKDVLVVEDIIDSGNTLSKVVEMLQTREPNSIQLCTLVCKPSRREIDLEVKFLGFEVEDKFIVGYGLDYDQKYRHLPFIGEIGL

Atome Classification :

(46 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3L5_A_3(5KNR)
?
[Raw transfer]




6WC_A_3(5KNX)
?
[Raw transfer]




6WB_B_5(5KNT)
?
[Raw transfer]




3L7_B_6(5KNS)
?
[Raw transfer]




3L5_B_5(5KNR)
?
[Raw transfer]




IMP_E_5(1G9S)
HPRT_ECOLI
[Raw transfer]




6W9_A_3(5KNV)
?
[Raw transfer]




5GP_E_5(1G9T)
HPRT_ECOLI
[Raw transfer]




3L7_A_3(5KNS)
?
[Raw transfer]




6WA_B_6(5KNU)
?
[Raw transfer]




6WC_B_5(5KNX)
?
[Raw transfer]




5GP_B_15(3KB8)
?
[Raw transfer]




6WC_B_5(5KNX)
?
[Raw transfer]




6W9_B_5(5KNV)
?
[Raw transfer]




3QE_B_9(4RHU)
HPRT_MYCTU
[Raw transfer]




6WA_A_3(5KNU)
?
[Raw transfer]




6WB_A_3(5KNT)
?
[Raw transfer]




45T_C_12(4RHU)
HPRT_MYCTU
[Raw transfer]




GOL_C_12(3O7M)
?
[Raw transfer]




GOL_A_5(3O7M)
?
[Raw transfer]




5GP_A_9(3KB8)
?
[Raw transfer]




IMP_A_9(1YFZ)
?
[Raw transfer]




IMP_B_10(1YFZ)
?
[Raw transfer]




MES_D_11(3HVU)
?
[Raw transfer]




MES_B_7(3HVU)
?
[Raw transfer]




MES_D_11(3HVU)
?
[Raw transfer]




MES_C_9(3HVU)
?
[Raw transfer]




MES_A_5(3HVU)
?
[Raw transfer]




7HP_B_8(1TC2)
?
[Raw transfer]




7HP_B_7(1I0L)
?
[Raw transfer]




7HP_B_8(1P18)
?
[Raw transfer]




SUC_B_10(3H83)
?
[Raw transfer]




5GP_B_8(5JV5)
HPRT_TRYBB
[Raw transfer]




5GP_A_6(4RHT)
HPRT_MYCTU
[Raw transfer]




6RH_A_3(5KAP)
HPRT_TRYBB
[Raw transfer]




6RH_B_9(5KAP)
HPRT_TRYBB
[Raw transfer]




N_F_6(1G9T)
HPRT_ECOLI
[Raw transfer]




5GP_B_10(4RHT)
HPRT_MYCTU
[Raw transfer]




N_F_6(1G9S)
HPRT_ECOLI
[Raw transfer]




SUC_A_6(3H83)
?
[Raw transfer]




5GP_A_3(5JV5)
HPRT_TRYBB
[Raw transfer]




5GP_D_18(4RHT)
HPRT_MYCTU
[Raw transfer]




5GP_C_14(4RHT)
HPRT_MYCTU
[Raw transfer]




7 PsiBlast_PDB 94.4160%-165 - C1 -5KNX 3.6 ?
124 HHSearch 93.7461%-156 - C1 -5KNX 5.2 ?
22 PsiBlast_CBE 93.3660%-156 - C1 -5KNX 5.2 ?
24 PsiBlast_CBE 92.3960%-168 - C1 -5KNU 3.4 ?
26 PsiBlast_CBE 91.9760%-168 - C1 -5KNS 6.1 ?
10 PsiBlast_PDB 91.2260%-164 - C1 -1GRV - HPRT_ECOLI -
2 PsiBlast_PDB 91.0760%-162 - C1 -5KNR 5.9 ?
25 PsiBlast_CBE 90.8460%-168 - C1 -5KNT 4.9 ?
29 PsiBlast_CBE 90.4160%-165 - C1 -1G9T 3.1 HPRT_ECOLI
3 PsiBlast_PDB 90.2760%-165 - C1 -5KNS 5.5 ?
5 PsiBlast_PDB 89.8760%-159 - C1 -5KNU 5.4 ?
6 PsiBlast_PDB 89.3060%-160 - C1 -5KNV 4.4 ?
30 PsiBlast_CBE 89.0560%-165 - C1 -1G9S 3.1 HPRT_ECOLI
27 PsiBlast_CBE 88.9860%-158 - C1 -5KNR 5.7 ?
9 PsiBlast_PDB 88.9760%-171 - C1 -1G9T 5.8 HPRT_ECOLI
4 PsiBlast_PDB 88.6560%-164 - C1 -5KNT 5.8 ?
8 PsiBlast_PDB 88.0360%-164 - C1 -1G9S 4.9 HPRT_ECOLI
1 PsiBlast_PDB 87.9561%-167 - C1 -1J7J - HPRT_SALTY -
23 PsiBlast_CBE 87.7060%-165 - C1 -5KNV 4.3 ?
12 PsiBlast_PDB 86.7358%-179 - C1 -4LYY - ? -
14 PsiBlast_PDB 83.9356%-160 - C1 -1YFZ 5.2 ?
31 PsiBlast_CBE 82.3856%-164 - C1 -1YFZ 5.6 ?
62 PsiBlast_CBE 81.3046%-185 - C1 -3O7M 2.7 ?
64 PsiBlast_CBE 80.7346%-182 - C1 -3O7M 2.0 ?
16 PsiBlast_PDB 79.9349%-153 - C1 -3H83 3.1 ?
125 HHSearch 78.9647%-149 - C1 -3HVU 2.3 ?
35 PsiBlast_CBE 78.5449%-153 - C1 -3KB8 5.6 ?
18 PsiBlast_PDB 77.2749%-154 - C1 -3KB8 5.6 ?
41 PsiBlast_CBE 77.1449%-147 - C1 -3H83 4.4 ?
17 PsiBlast_PDB 76.7749%-147 - C1 -3HVU 2.3 ?
56 PsiBlast_CBE 76.4947%-177 - C1 -4RHT 5.3 HPRT_MYCTU
38 PsiBlast_CBE 76.2649%-149 - C1 -3HVU 2.0 ?
37 PsiBlast_CBE 76.0449%-146 - C1 -3HVU 2.2 ?
36 PsiBlast_CBE 75.2449%-144 - C1 -3HVU 2.3 ?
57 PsiBlast_CBE 73.0547% -82 - C1 -4RHT 3.6 HPRT_MYCTU
54 PsiBlast_CBE 70.7547% -33 - C1 -4RHU 6.1 HPRT_MYCTU
59 PsiBlast_CBE 70.5447% -75 - C1 -4RHT 3.3 HPRT_MYCTU
53 PsiBlast_CBE 69.3747% -47 - C1 -4RHU 6.2 HPRT_MYCTU
58 PsiBlast_CBE 66.2547% -69 - C1 -4RHT 3.2 HPRT_MYCTU
73 PsiBlast_CBE 65.5738% -33 - C1 -1P18 3.8 ?
81 PsiBlast_CBE 64.7938% -32 - C1 -1TC2 3.9 ?
87 PsiBlast_CBE 64.3537% -30 - C1 -1I0L 3.7 ?
102 PsiBlast_CBE 59.7136% -13 - C1 -5JV5 3.9 HPRT_TRYBB
95 PsiBlast_CBE 58.9836% -17 - C1 -5KAP 3.3 HPRT_TRYBB
101 PsiBlast_CBE 58.1836% -10 - C1 -5JV5 3.8 HPRT_TRYBB
96 PsiBlast_CBE 56.3536% -17 - C1 -5KAP 3.3 HPRT_TRYBB