@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : B0VUC3: (2017-12-17 )
MPWLYWTLKPKHRIWAEEWQKEYQAYLMDMETVEIGENCFISPLAHIFAEPGRKIKIGDNCFIAADCSLHGPLEIGNEVAINHHCILDGGRAGIKLHDQVRIAAYCHLYAFDHGMQLDRPLYQQPVRSQGIEIEKDVWLGAHVGIKDGIKIGKHAVVGMNSMVTKDVEPYHIVGGNPAKFIRLRE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_B_18(3SRT)
?
[Raw transfer]




12 PsiBlast_PDB 84.6730%-152 - C1 -3VBK - ? -
16 PsiBlast_PDB 83.7730%-145 - C1 -3VBJ - ? -
18 PsiBlast_PDB 83.4530%-153 - C1 -3VBL - ? -
17 PsiBlast_PDB 83.1830%-145 - C1 -3VBM - ? -
14 PsiBlast_PDB 82.3730%-146 - C1 -3VBN - ? -
15 PsiBlast_PDB 82.2230%-150 - C1 -3VBI - ? -
13 PsiBlast_PDB 82.1329%-142 * C1 *3VBP - ? -
5 PsiBlast_PDB 78.1527% - - C1 -4DCL - ATRF2_STAAC -
80 HHSearch 76.3630%-145 - C1 -3VBM - ? -
79 HHSearch 74.6227%-145 - C1 -3VBI - ? -
93 HHSearch 67.0131%-199 - C1 -3R8Y - DAPH_BACAN -
4 PsiBlast_PDB 55.9128% 4 - C1 -5U2K - ATRF2_STAAC -
2 PsiBlast_PDB 55.7328% 6 - C1 -5V0Z - ATRF2_STAAC -
20 PsiBlast_PDB 54.8430% -36 - C1 -2IC7 - ? -
3 PsiBlast_PDB 53.4527% 15 - C1 -4EGG - ATRF2_STAAC -
81 HHSearch 52.4526% -41 - C1 -3JQY - NEUO_ECOK1 -
11 PsiBlast_PDB 52.4228% 0 - C- -3FTT - ATRF2_STAAC -
98 HHSearch 51.3222% -92 - C1 -1J2Z - LPXA_HELPY -
1 PsiBlast_PDB 51.3128% 7 - C1 -3V4E - ATRF2_STAAC -
91 HHSearch 49.4824% -18 - C1 -2WLF - OATWY_NEIME -