@TOME V2.3
(Mar 2018)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Modeled complexes Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor model: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : I3U1D8: (2017-12-20 )
MNVEKLGGKTMTAKISVIMGSTSDWETMKEACQILDEFGVSYEKKVVSAHRTPDLMFEYAQNARKKGIKIIIAGAGGAAHLPGMVASKTTLPVIGVPVQSRTLNGLDSLLSIVQMPGGVPVATTAIGKAGAINAGLLAIQMLSMYDLELEAKLAERRSMLAKTVIESSDQLG

Atome Classification :

(44 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NIA_A_2(2NSH)
PURE_ECOLI
[Raw transfer]




C2R_I_9(2NSL)
PURE_ECOLI
[Raw transfer]




AIR_A_3(5CLJ)
?
[Raw transfer]




AIR_A_3(5CLI)
?
[Raw transfer]




C2R_I_9(2NSJ)
PURE_ECOLI
[Raw transfer]




AIR_A_3(2FWI)
?
[Raw transfer]




AIR_I_9(2FWJ)
?
[Raw transfer]




RP5_A_7(4Z7J)
?
[Raw transfer]




CIT_M_13(2FWP)
?
[Raw transfer]




CIT_A_3(1U11)
?
[Raw transfer]




CIT_B_3(2FW6)
?
[Raw transfer]




CIT_A_4(5CVT)
?
[Raw transfer]




CIT_B_6(5CVT)
?
[Raw transfer]




CIT_B_3(5CLG)
?
[Raw transfer]




FMT_D_25(3OPQ)
?
[Raw transfer]




FMT_A_7(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_C_21(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_C_21(3LP6)
PURE_MYCTU
[Raw transfer]




CIT_B_4(1U11)
?
[Raw transfer]




FMT_A_7(3LP6)
PURE_MYCTU
[Raw transfer]




GOL_B_9(3LP6)
PURE_MYCTU
[Raw transfer]




FMT_D_23(3LP6)
PURE_MYCTU
[Raw transfer]




CIT_B_4(1U11)
?
[Raw transfer]




CIT_B_5(5CLJ)
?
[Raw transfer]




FMT_D_26(3LP6)
PURE_MYCTU
[Raw transfer]




EDO_A_3(5CLF)
?
[Raw transfer]




EDO_B_10(4Z7J)
?
[Raw transfer]




EDO_A_4(4ZC8)
?
[Raw transfer]




EDO_B_6(5CLF)
?
[Raw transfer]




ACY_I_9(2FW1)
?
[Raw transfer]




ACY_M_13(2FW1)
?
[Raw transfer]




EDO_A_5(4ZC8)
?
[Raw transfer]




90 HHSearch 95.8270%-142 - C4 -1XMP - ? -
4 PsiBlast_PDB 94.8070%-140 - C4 -1XMP - ? -
85 HHSearch 94.0469%-138 - C4 -4AY3 - ? -
2 PsiBlast_PDB 93.8669%-141 - C4 -4AY3 - ? -
3 PsiBlast_PDB 93.2669%-140 - C4 -4AY4 - ? -
5 PsiBlast_PDB 93.1160%-148 - C4 -3OOW - ? -
70 Fugue 93.0460%-159 - C4 -1O4V - PURE_THEMA -
79 HHSearch 92.7261%-147 - C4 -3ORS - ? -
93 HHSearch 92.6562%-143 - C4 -3OOW - ? -
88 HHSearch 92.6463%-148 - C4 -3OPQ 3.3 ?
82 HHSearch 91.8255%-158 - C4 -3LP6 3.6 PURE_MYCTU
89 HHSearch 91.2055%-154 - C4 -1D7A - PURE_ECOLI -
6 PsiBlast_PDB 91.0460%-144 - C4 -3OPQ - ? -
7 PsiBlast_PDB 90.8960%-158 - C4 -1O4V - PURE_THEMA -
86 HHSearch 90.3860%-159 - C4 -1O4V - PURE_THEMA -
27 PsiBlast_CBE 90.3756%-160 - C4 -3LP6 3.4 PURE_MYCTU
28 PsiBlast_CBE 90.1556%-161 - C4 -3LP6 3.6 PURE_MYCTU
81 HHSearch 89.6055%-155 - C4 -3LP6 3.4 PURE_MYCTU
8 PsiBlast_PDB 88.9156%-156 - C4 -3LP6 3.4 PURE_MYCTU
36 PsiBlast_CBE 88.7956%-158 - C4 -4YCJ - ? -
29 PsiBlast_CBE 88.7256%-156 - C4 -3LP6 3.6 PURE_MYCTU
11 PsiBlast_PDB 88.4856%-155 - C4 -5CLF 3.7 ?
66 PsiBlast_CBE 88.3352%-151 - C4 -2NSL 6.1 PURE_ECOLI
10 PsiBlast_PDB 88.2856%-152 - C4 -2FWJ 4.7 ?
67 PsiBlast_CBE 88.2152%-150 - C4 -2NSJ 5.9 PURE_ECOLI
31 PsiBlast_CBE 88.1656%-153 - C4 -2FW1 3.3 ?
9 PsiBlast_PDB 87.9856%-153 - C4 -2FW1 3.6 ?
14 PsiBlast_PDB 87.9756%-154 - C4 -4ZC8 3.3 ?
34 PsiBlast_CBE 87.9056%-158 - C4 -4Z7J 3.5 ?
44 PsiBlast_CBE 87.8856%-155 - C4 -2FWI 3.8 ?
41 PsiBlast_CBE 87.8456%-148 - C4 -2FWP 4.0 ?
15 PsiBlast_PDB 87.7956%-155 - C4 -4Z7J 3.4 ?
37 PsiBlast_CBE 87.7856%-147 - C4 -5CLJ 4.1 ?
38 PsiBlast_CBE 87.7656%-153 - C4 -5CLJ 4.4 ?
13 PsiBlast_PDB 87.6756%-152 - C4 -1U11 3.8 ?
68 PsiBlast_CBE 87.5952%-147 - C4 -2NSH 5.7 PURE_ECOLI
61 PsiBlast_CBE 87.3756%-158 - C4 -5CVT 2.9 ?
32 PsiBlast_CBE 87.3456%-153 - C4 -1U11 3.7 ?
40 PsiBlast_CBE 87.2356%-148 - C4 -5CLG 3.9 ?
91 HHSearch 87.2154%-145 - C4 -1U11 3.7 ?
60 PsiBlast_CBE 87.2056%-156 - C4 -5CVT 3.0 ?
30 PsiBlast_CBE 86.9956%-155 - C4 -5CLF 3.6 ?
42 PsiBlast_CBE 86.8056%-149 - C4 -2FW6 3.6 ?
12 PsiBlast_PDB 86.6856%-153 - C4 -5CLI 4.6 ?