@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF00248_AK1C3_: (2014-09-03 )
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY

Atome Classification :

(68 SA) .........10........20....-....30........40........50........60........-70........80........90........100.......110.......120...--------....130.......-140.......150..---.....160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......-300-....---------...310....-...320.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDSKHQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
20 PsiBlast_PDB 95.7299%-108 - C8 -1ZQ5 AK1C3_HUMAN A:[5-321] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSP---NGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSD--
12 PsiBlast_PDB 95.72100%-111 - C8 -4FAL AK1C3_HUMAN A:[5-323] ----HQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKP---------------------IF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
1 PsiBlast_PDB 95.71100%-106 - C8 -3R43 AK1C3_HUMAN A:[6-321] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPT------IF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSD--
33 PsiBlast_CBE 95.5999%-107 - C8 -1S1R AK1C3_HUMAN A:[6-321] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSD--
48 PsiBlast_CBE 95.5786%-105 - C8 -2IPJ AK1C2_HUMAN B:[1-321] --SKYQCVKLNDGHFMPVLGFGTAA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EEVIPKDENGKILF-DTVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN-VRYL---------TLDIFAGPPN-YPFSDEY
28 PsiBlast_CBE 95.4299%-106 - C8 -2FGB AK1C3_HUMAN A:[1-323] MDSKQQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------E-----------IF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
49 PsiBlast_CBE 95.2486%-104 - C8 -2IPJ AK1C2_HUMAN A:[1-321] --SKYQCVKLNDGHFMPVLGFGTAA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EEVIPKDENGKILF-DTVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN-VRYL---------TLDIFAGPPN-YPFSDEY
47 PsiBlast_CBE 95.2086%-108 - C8 -1J96 AK1C2_HUMAN A:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EEVIPKDENGKILF-DTVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN-VRYL---------TLDIFAGPPN-YPFSDEY
15 PsiBlast_PDB 95.17100%-108 - C8 -4HMN AK1C3_HUMAN A:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKP--------------------VIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
11 PsiBlast_PDB 95.09100%-112 - C8 -4FA3 AK1C3_HUMAN A:[6-322] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------------------IF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDE-
2 PsiBlast_PDB 95.09100%-110 - C8 -3R58 AK1C3_HUMAN A:[6-322] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKP---------------------IF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDE-
29 PsiBlast_CBE 95.0299%-107 - C8 -1RY8 AK1C3_HUMAN B:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
8 PsiBlast_PDB 95.02100%-113 - C8 -3UFY AK1C3_HUMAN A:[6-321] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKP---------------------IF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSD--
30 PsiBlast_CBE 94.9999%-108 - C8 -1RY0 AK1C3_HUMAN B:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
32 PsiBlast_CBE 94.9799%-108 - C8 -1S2A AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYS---
44 PsiBlast_CBE 94.9486%-104 - C8 -1XJB AK1C2_HUMAN B:[4-325] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EEVIPKDENGKILF-DTVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN-VRYL---------TLDIFAGPPN-YPFSDEY
22 PsiBlast_CBE 94.9399%-108 - C8 -4DBW AK1C3_HUMAN B:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
40 PsiBlast_CBE 94.8186%-104 - C8 -2HDJ AK1C2_HUMAN B:[2-323] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EEVIPKDENGKILF-DTVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN-VRYL---------TLDIFAGPPN-YPFSDEY
75 HHSearch 94.76100%-107 - C8 -1S1P AK1C3_HUMAN A:[6-320] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYS---
16 PsiBlast_PDB 94.7599%-108 - C8 -1RY0 AK1C3_HUMAN A:[5-323] ----QQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
24 PsiBlast_CBE 94.7399%-103 - C8 -4DBU AK1C3_HUMAN B:[6-323] -----QCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPG--------EELSPTDENGKVIF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSDEY
45 PsiBlast_CBE 94.7086%-106 - C8 -1XJB AK1C2_HUMAN A:[4-325] -DSKYQCVKLNDGHFMPVLGFGTYA-PAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPG--------EEVIPKDENGKILF-DTVDLCATWEAMEKC---KDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGL-NRN-VRYL---------TLDIFAGPPN-YPFSDEY
35 PsiBlast_CBE 94.7099%-109 - C8 -4DZ5 AK1C3_HUMAN A:[4-321] ---KHQCVKLNDGHFMPVLGFGTYA-PPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKI-ADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKP---------------------IF-DIVDLCTTWEAMEKC---KDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRFVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGL-DRN-LHYF---------NSDSFASHPN-YPYSD--