@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : PF02569_PANC_M: (2014-09-30 )
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN

Atome Classification :

(66 SA) .........10........20........30........40........50........60........70........80........90........100.......110..--.....120-.-.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220....-.---.---.230.......240.......250...-.-...260-.-----.......270.......280.......290.......300.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN
51 PsiBlast_CBE 96.2099%-134 - C7 -1MOP PANC_MYCTU B:[2-288] -AIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGA---LDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIG---------------------
10 PsiBlast_PDB 96.0199%-131 - C7 -4DE5 PANC_MYCTU A:[3-291] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGTFA------------------
4 PsiBlast_PDB 95.8999%-129 - C7 -3IVC PANC_MYCTU A:[1-298] MAIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDG-----------
5 PsiBlast_PDB 95.5599%-132 - C7 -3IVG PANC_MYCTU A:[3-289] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGT--------------------
48 PsiBlast_CBE 95.5399%-133 - C7 -1N2G PANC_MYCTU B:[2-288] -AIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGA---LDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIG---------------------
6 PsiBlast_PDB 95.4099%-131 - C7 -3IVX PANC_MYCTU A:[3-290] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGTF-------------------
17 PsiBlast_PDB 95.3999%-132 - C7 -1N2I PANC_MYCTU A:[3-288] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIG---------------------
47 PsiBlast_CBE 95.3899%-131 - C7 -1N2H PANC_MYCTU B:[2-288] -AIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIG---------------------
8 PsiBlast_PDB 95.3699%-129 - C7 -4DDK PANC_MYCTU A:[3-291] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGTFA------------------
3 PsiBlast_PDB 95.3599%-129 - C7 -3IUE PANC_MYCTU A:[3-290] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGTF-------------------
30 PsiBlast_CBE 95.2599%-138 - C7 -3IUE PANC_MYCTU B:[1-288] MAIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQ----------PRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIG---------------------
18 PsiBlast_PDB 95.1899%-128 - C7 -1N2J PANC_MYCTU A:[3-289] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGT--------------------
11 PsiBlast_PDB 95.1699%-129 - C7 -4FZJ PANC_MYCTU A:[3-289] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGT--------------------
14 PsiBlast_PDB 95.1299%-129 - C7 -1N2E PANC_MYCTU A:[3-290] --IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGL--RTTVQP-G-P-LAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATA-G---A---QAALDAARAVLDAAPGVAVDYLELRDI-G-LGPM-P-L-----NGSGRLLVAARLGTTRLLDNIAIEIGTF-------------------