@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ACTHR_HUMAN: (2016-01-08 )
MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW

Atome Classification :

(20 SA) .........10........20........30........40........50........60........70......-..80........90........100.......110...-..-..120.......130.......140--........150......--------------------------.160---......-.170--------------------.----------------------..------------------------......180.....---..190.......200......--------------------------------------------------------------------------------------------------------------------------------------------------------------.210---------.------------------------------------------------------------------------------------------------------------------------------------------------------------...---------....220.......230...----....240.......250.......260.......270.......280.......290.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYK-ILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLL-GS-IFSLSVIAADRYITIFHALRYHSI---VTMRRTVVVLTVIWTFC--------------------------TGTG---ITMVIF-SH----------------------H----------------------VP------------------------TVITFTSLFPLMLV---FILCLYVHMFLLARSHTRKIS--------------------------------------------------------------------------------------------------------------------------------------------------------------TLP----------R------------------------------------------------------------------------------------------------------------------------------------------------------------ANM---------KGAITLTILLGVFIFCWAPF----VLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW
36 HHSearch 90.6825%-156 - C4 -2RH1 ADRB2_HUMAN (first) A:[45-477] ----------------------------IVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHI---LMKMWTFGNFWCEFWTSIDV---LCVT-AS-IETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVS--------------------------GLTS---FLPIQMHWYRATHQEAINCYAEETCCDFFTNQ----------------------AY------------------------AIASSIVSFYVPLV---IMVFVYSRVFQEAKRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY--KFC----------L------------------------------------------------------------------------------------------------------------------------------------------------------------KEH---------KALKTLGIIMGTFTLCWLPF----FIVNIVHVIQDNL-I---RKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAFQELLCL----
1 PsiBlast_PDB 89.0627%-171 - C4 -2YDO ? A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLA-IPFAIAI---------STGFCAACHGCLFIACFVLVLT-ASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHSQGCGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------S--TL--------Q------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSLAIIVGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR
38 HHSearch 88.9929%-156 - C4 -3EML ENLYS_BPT4 A:[26-468] ----------------------------TVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLA-IPFAITIS----T-GFCAACHGCLFIACFVL---VLTQ-SS-IFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLS--------------------------FAIG---LTPMLG-WN----------------------NCGQSQGCGEGQVACLFEDVVPMNYM-----------------------VYFNFFACVLVPLL---LMLGVYLRIFLAARRQLNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYR-STL----------Q------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSLAIIVGLFALCWLPL----HIINCFTFFCPDCSH--APLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR
7 PsiBlast_PDB 88.4827%-165 - C4 -3PWH ? A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLA-IPFAITI---------STGFCAACHGCLFIACFVLVLAQSS-IFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPG--------CGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQPLPGERARSTLQ------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSAAIIAGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLAHTNSVVNPFIYAYRIREFRQTFRKIIRS----
8 PsiBlast_PDB 88.2327%-164 - C4 -3REY AA2AR_HUMAN A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLA-IPFAITI---------STGFCAACHGCLFIACFVLVLAQSS-IFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPG--------CGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQPLPGERARSTLQ------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSAAIIAGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLAHTNSVVNPFIYAYRIREFRQTFRKIIRS----
9 PsiBlast_PDB 88.1427%-164 - C4 -3RFM AA2AR_HUMAN A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLA-IPFAITI---------STGFCAACHGCLFIACFVLVLAQSS-IFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPG--------CGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQPLPGERARSTLQ------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSAAIIAGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLAHTNSVVNPFIYAYRIREFRQTFRKIIRS----
3 PsiBlast_PDB 88.1427%-174 - C4 -4UG2 ? A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLA-IPFAIAI---------STGFCAACHGCLFIACFVLVLT-ASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHSQGCGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQL---------------------------------------------------------------------------------------------------------------------------------------------------------------------ARSTL-----Q------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSLAIIVGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR
53 Fugue 88.0324%-170 - C4 -2RH1 ADRB2_HUMAN (first) A:[36-477] -------------------DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLA-------VVPFGAAHILMKMWTFGNFWCEFWTSIDVLCVT-AS-IETLCVIAVDRYFAITSPFKYQSL---LTKNKARVIILMVWIVS--------------------------GLTS---FLPIQM-HW----------------------Y----------------------RATHQEAINCYAEETCCDFFTNQAY-AIASSIVSFYVPLV---IMVFVYSRVFQEAKRQLNIFE--------------------------------------------------------------------------------------------------------------------------------------------------------------MLR----------IDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKEH---------KALKTLGIIMGTFTLCWLPF----FIVNIVHVIQDN----LIRKEVYILLNWIGYVNSGFNPLIYCR-SPDFRIAFQELLCL----
2 PsiBlast_PDB 87.8827%-171 - C4 -2YDV ? A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLA-IPFAIAI---------STGFCAACHGCLFIACFVLVLT-ASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAHSQGCGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQ-STL-------Q------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSLAIIVGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR
4 PsiBlast_PDB 87.7627%-173 - C4 -4UHR AA2AR_HUMAN A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSAAAADILVGVLA-IPFAIAI---------STGFCAACHGCLFIACFVLVLT-ASSIFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKAG---CGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQPLPGERARSTLQ------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSLAIIVGLFALCWLPL----HIINCFTFFCPDC-HAPLWLMYLAI--VLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR
10 PsiBlast_PDB 87.6327%-165 - C4 -3UZA AA2AR_HUMAN A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLA-IPFAITI---------STGFCAACHGCLFIACFVLVLAQSS-IFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPG--------CGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQPLPGERARSTLQ------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSAAIIAGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLAHTNSVVNPFIYAYRIREFRQTFRKIIRS----
5 PsiBlast_PDB 87.5727%-165 - C4 -3VG9 ? A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLA-IPFAITI---------STGFCAACHGCLFIACFVLVLTQSS-IFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQSQG-------CGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQPLPGERARSTLQ------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSLAIIVGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLR
11 PsiBlast_PDB 87.1527%-165 - C4 -3UZC AA2AR_HUMAN A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADILVGVLA-IPFAITI---------STGFCAACHGCLFIACFVLVLAQSS-IFSLLAIAIDRYIAIAIPLRYNGL---VTGTRAAGIIAICWVLSFAIGLTPMLGWNNCGQPG--------CGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFAAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQPLPGERARSTLQ------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSAAIIAGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLAHTNSVVNPFIYAYRIREFRQTFRKIIRS----
6 PsiBlast_PDB 86.2927%-169 - C4 -3VGA AA2AR_HUMAN A:[15-303] --------------------------------AIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLA-IPFAITI---------STGFCAACHGCLFIACFVLVLTQSS-IFSLLAIAIDRYIAIRIPLRYNGL---VTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQSQG-------CGEG---QVACLF-ED----------------------V----------------------VPM-----------------------NYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQME--------------------------------------------------------------------------------------------------------------------------------------------------------------SQPLPGERARSTLQ------------------------------------------------------------------------------------------------------------------------------------------------------------KEV---------HAAKSLAIIVGLFALCWLPL----HIINCFTFFCPDCSHAPLWLMYLAI--VLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVL-
35 HHSearch 84.9723%-161 * C4 *3PBL DRD3_HUMAN (first) A:[43-472] ----------------------------LSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLV-MPWVVYLEV--TGGVWNFSRICCDVFVTLDV---MMCT-AS-IWNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLA--------------------------FAVS---CPLLFG-FN----------------------TTGDPTVCSISNP----------DF------------------------VIYSSVVSFYLPFG---VTVLVYARIYVVLKQRRRKNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYGVP----------L------------------------------------------------------------------------------------------------------------------------------------------------------------REK---------KATQMVAIVLGAFIVCWLPF----FLTHVLNTHCQTC---HVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC----
44 HHSearch 84.3421%-153 - C4 -2Z73 OPSD_TODPA A:[39-332] ----------------------------IFIGICGIIGCGGNGIVIYLFTKTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISC---FLKKWIFGFAACKVYGFIGG---IFGF-MS-IMTMAMISIDRYNVIGRPMAASKK---MSHRRAFIMIIFVWLWS--------------------------VLWA---IGPIFG-WG----------------------AYTLEGVLCNCSFDYISRDSTTRSN------------------------ILCMFILGFFGPIL---IIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELRKAQ-----------------------------------------------------------------------------------------------------------------------------------------------AGA----------N------------------------------------------------------------------------------------------------------------------------------------------------------------AEM---------RLAKISIVIVSQFLLSWSPY----AVVALLAQFGPLEW---VTPYAAQLPVMFAKASAIHNPMIYSVSHPKFREAISQTFPWVLTC
41 HHSearch 83.0326%-156 - C4 -3V2Y ENLYS_BPT4 A:[68-495] ----------------------------VVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAY-TANLLLSG----ATTYKLTPAQWFLREGSMF---VALS-AS-VFSLLAIAIERYITMLK-----------NNFRLFLLISACWVIS--------------------------LILG---GLPIMG-WN----------------------CISALSSCSTVLPLYH-------KH------------------------YILFCTTVFTLLLL---SIVILYCRIYSLVRTRNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYA--SRS----------S------------------------------------------------------------------------------------------------------------------------------------------------------------ENV---------ALLKTVIIVLSVFIACWAPL----FILLLLDVGCKVKTC--DILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMGRPL--
32 HHSearch 82.7723%-149 - C4 -3UON ACM2_HUMAN (first) A:[28-457] ----------------------------LVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNYFLFSLACADLIIGVFS-MNLYTLYT---VIGYWPLGPVVCDLWLALDY---VVSN-AS-VMNLLIISFDRYFCVTKPLTYPVK---RTTKMAGMMIAAAWVLS--------------------------FILW---APAILF-WQ----------------------FIVGVRTVEDGECYIQFFSNA--AV------------------------TFGTAIAAFYLPVI---IMTVLYWHISRASKSRINIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAY--PPP----------S------------------------------------------------------------------------------------------------------------------------------------------------------------REK---------KVTRTILAILLAFIITWAPY----NVMVLINTFCAPCI----PNTVWTIGYWLCYINSTINPACYALCNATFKKTFKHLLM-----
17 PsiBlast_PDB 82.3126%-175 - C4 -2Y00 ADRB1_MELGA A:[26-299] --------------------------------------VAGNVLVIAAIGSTQRLQTLTNLFITSLACADLVVGLLV-VPFGATLVVRGTWLW---GSFLC---ELWTSLDVLCVT-AS-IETLCVIAIDRYLAITSPFRYQSL---MTRARAKVIICTVWAIS--------------------------ALVSFLPIMMHWW-RD----------------------E----------------------DPQALKCYQDPGCCDFVTNRAYAIASSIISF--YIPLLIM---IFVALRVYR--EAKEQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SRVMLMREHKALKTLGIIMGVFTLCWLPFFLVNIVNVFNRDLVPD--------WLFVAFNWLGYANSAMNPIIYC-RSPDFRKAFKRLLA-----