@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ADA2B_HUMAN: (2016-01-08 )
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRILCRPWTQTAW

Atome Classification :

(20 SA) -------------------------.........10........20........30........40........50........60....-....70....-....80........90........100.......110....---...120-.........130.......140.......---150.......160.------.---....--------.------.-170-........180.......190-.......200.-------.--------.....210--------.......---..220......------...230-----...-.....240.--......250.......260---........------270..--------.....280---------........290.......300-----.........310.......320.....-..330.......340.......350.......360.......370.......380.......390....-...400.......410.......420.......430..-.....440.....------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------------------MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLI-IPFSLANELL-GYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSR---ALEY---NSKRTPRRIKCIILTVWLIAAVISLPPLI---YKGDQGPQPRG-RP------Q---CKLN--------Q------E-AW--YILASSIGSFFAPCLIMILVY-LRIYLIAKRSN-------R--------RGPRAK----------GGPGQGE---SKQ--PRPDHG------GALAS------AKL-PALASVASA--REVNGHSKSTGEKEEGET----PEDTGTRA------LPPSW--------AALPNS-G---------QGQKEGVCGASPEDEAEEE-------EEEEEECEPQAVPVSPASACSPPLQQP-QGSRVLATLRGQVLLGRGVGAIGGQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPK-HCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAF-RRILCRPWTQTAW------------
8 PsiBlast_PDB 87.8928%-164 - C3 -3P0G ENLYS_BPT4 A:[42-477] -------------------------------------VGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITS---PFKY---QSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINC-YA------EETCCDFF--------T------N-QA--YAIASSIVSFYVPLVIMVFVY-SRVFQEAK------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LKEHKALK-TLGIIMGTFTLCWLPFFIVNIVHVI--Q-DNLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAF-QELLCLRR-----------------
2 PsiBlast_PDB 85.0232% -95 - C3 -3PBL DRD3_HUMAN (first) A:[48-470] ----------------------------------------------LILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLV-MPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVM---PVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLF--------GFNTTG-DP------T---VCSI--------S------N-PD--FVIYSSVVSFYLPFGVTVLVY-ARIYVVLKQRR-------R--------KNIFEM----------LRIDEGL---RLK--IYKDTE------GYYTIGIGHLLTKS-PSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINM-VF--------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTWDAYGVPL-REKKATQMVAIVLGAFIVCWLPFFLTHVLNTHC-Q-TCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAF-LKILSC-------------------
21 PsiBlast_CBE 84.5232% -97 - C3 -3PBL DRD3_HUMAN (first) B:[48-470] ----------------------------------------------LILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLV-MPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASIWNLCAISIDRYTAVVM---P---------SSCRRVALMITAVWVLAFAVSCPLLF--------GFNTTG-DP------T---VCSI--------S------N-PD--FVIYSSVVSFYLPFGVTVLVY-ARIYVVLKQRR-------R--------KNIFEM----------LRIDEGL---RLK--IYKDTE------GYYTIGIGHLLTKS-PSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINM-VF--------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTWDAYGVPL-REKKATQMVAIVLGAFIVCWLPFFLTHVLNTHC-Q-TCHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAF-LKILSC-------------------
5 PsiBlast_PDB 83.0928% -92 - C3 -3NY8 ENLYS_BPT4 A:[41-477] ------------------------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIWTLCVIAVDRYFAITS---PFKY---QSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINC-YA------EETCCDFF--------T------N-QA--YAIASSIVSFYVPLVIMVFVY-SRVFQEAKRQL-------NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLL---TKS--P------------SLNA------AK---SELDKAIG--RNTNGVITKDEAEKLFNQ----DVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVF---------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTWDAYKFCLKEHKALK-TLGIIMGTFTLCWLPFFIVNIVHVI--Q-DNLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAF-QELLCL-------------------
9 PsiBlast_PDB 82.7928% -91 - C3 -3PDS ADRB2_HUMAN (first) A:[9-445] ------------------------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAACILM-KMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITS---PFKY---QSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINC-YA------EETCCDFF--------T------N-QA--YAIASSIVSFYVPLVIMVFVY-SRVFQEAKRQL-------N--------IFEMLR----------IDEGL-R---LKI--YKDTEGYYTIGIGHLLT-------KS-PSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINM-VF--------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTWDAYKFCLKEHKALK-TLGIIMGTFTLCWLPFFIVNIVHVI--Q-DNLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAF-QELLCL-------------------
3 PsiBlast_PDB 82.2228% -93 - C3 -2RH1 ADRB2_HUMAN (first) A:[41-476] -------------------------------------VGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITS---PFKY---QSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINC-YA------EETCCDFF--------T------N-QA--YAIASSIVSFYVPLVIMVFVY-SRVFQEAKRQL-------NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLL---TKS--P------------SLNA------AK---SELDKAIG--RNTNGVITKDEAEKLFNQ----DVDAAVRGILRNAKLKPVYDSLDAVRRAALINM-VF--------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTWDAYKFCLKEHKALK-TLGIIMGTFTLCWLPFFIVNIVHVI--Q-DNLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAF-QELLCL-------------------
6 PsiBlast_PDB 82.0328% -93 - C3 -3NY9 ADRB2_HUMAN (first) A:[41-477] ------------------------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIWTLCVIAVDRYFAITS---PFKY---QSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINC-YA------EETCCDFF--------T------N-QA--YAIASSIVSFYVPLVIMVFVY-SRVFQEAKRQL-------NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLL---TKS--P------------SLNA------AK---SELDKAIG--RNTNGVITKDEAEKLFNQ----DVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVF---------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTWDAYKFCLKEHKALK-TLGIIMGTFTLCWLPFFIVNIVHVI--Q-DNLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAF-QELLCL-------------------
4 PsiBlast_PDB 81.1328% -94 - C3 -3D4S ENLYS_BPT4 A:[41-477] ------------------------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIWTLCVIAVDRYFAITS---PFKY---QSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINC-YA------EETCCDFF--------T------N-QA--YAIASSIVSFYVPLVIMVFVY-SRVFQEAKRQL-------NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLL---TKS--P------------SLNA------AK---SELDKAIG--RNTNGVITKDEAEKLFNQ----DVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVF---------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTWDAYKFCLKEHKALK-TLGIIMGTFTLCWLPFFIVNIVHVI--Q-DNLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAF-QELLCL-------------------
7 PsiBlast_PDB 80.9328% -91 - C3 -3NYA ADRB2_HUMAN (first) A:[41-477] ------------------------------------VVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIWTLCVIAVDRYFAITS---PFKY---QSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQEAINC-YA------EETCCDFF--------T------N-QA--YAIASSIVSFYVPLVIMVFVY-SRVFQEAKRQL-------NIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLL---TKS--P------------SLNA------AK---SELDKAIG--RNTNGVITKDEAEKLFNQ----DVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVF---------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTWDAYKFCLKEHKALK-TLGIIMGTFTLCWLPFFIVNIVHVI--Q-DNLIRKEVYILLNWIGYVNSGFNPLIYC-RSPDFRIAF-QELLCL-------------------
1 PsiBlast_PDB 80.7428% -95 - C3 -4IAR C562_ECOLX A:[11-395] ---------------------------YQDSISLPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILV-MPISTMYTVT-GRWTLGQVVCDFWLSSDITCCTASIWHLCVIALDRYWAITD---AVEY---SAKRTPKRAAVMIALVWVFSISISLPPFF---WR--QA-------S------E---CVVN--------T------DHIL--YTVYSTVGAFYFPTLLLIALY-GRIYVEAR--S-------R--------IADLED----------NWETLND---NLKVIEKADNA------AQVKD------ALT-KMRAAALDA--Q------KATPPKLEDKS----PDSPEMKD------FRHGF--------DILV--------------GQIDDALKLANEGKVKEA-------QAAAEQ---------------------------LKTTRNAYI--------------QKYLAARERKATKTLGIILGAFIVCWLPFFIISLVMPI------WFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAF-HKLIRFK------------------
15 PsiBlast_PDB 79.0725%-103 - C3 -4U15 ACM3_RAT A:[8-398] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIM-NRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITR---PLTY---RAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPG-EC------F---IQFL--------S------E-PT--ITFGTAIAAFYMPVTIMTILY-WRIYKETEKMNIFEML--R--------IDEGGG----------SGGDEAEKLFNQD--VDAAVR------GILRN------AKLKPVYDSLDAV--RR-----------------------------------------------AALINMVF---------QMGETGVAGFTNSLRMLQQ-------KRWDEA----AVNLAKSRWYN---QTPNRAKRVITTFR------------TGTW---DAYLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFC-D-SC-IPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTF-KTL----------------------
45 Fugue 77.8524% -78 - C3 -2RH1 ADRB2_HUMAN (first) A:[36-477] --------------------------------DEVWVVGMGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAV-VPFGAAHILM-KMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITS---PFKY---QSLLTKNKARVIILMVWIVSGLTSFLPIQ---MHWYRATHQEA-INCYAEETC---CDFF--------T------N-QA--YAIASSIVSFYVPLVIMVFVY-SRVFQEAKRQL-------N--------IFEMLR----------IDEGL-R---LKI--YKDTEG------YYTIG------IGH-LLTKSPSLN--AAKSELDKAIGRNTNGVI----TKDEAEKL------FNQDV--------DAAVRG-I---------LRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAV-NLAKSRWYNQTPNRAKRVITTFRTGTWDAYKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDN-L--IRKEVYILLNWIGYVNSGFNPLIYCR-SPDFRIAF-QELLCL-------------------
14 PsiBlast_PDB 77.8125% -94 - C3 -4U14 ENLYS_BPT4 A:[8-442] --------------------------------TIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS-MNLFTTYIIM-NRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITR---PLTY---RAKRTTKRAGVMIGLAWVISFVLW