@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Lmo1713: (2016-03-28 )
MFGTTTIGIDLGTANILVYSKEKGIILNEPSVVALNTNDGTVLAIGQEAKEMIGKTPTSISAVRPMKDGVIADFDLTSGLLREIMRRISVSGVRKPNVVVCTPTGATSVERRAISDAVRSTGARSVVLIEEPVAAAIGADLPVAEPVANVIVDIGGGTSEIAIISYGGVVSSTSIRTGGDHMDEEIIQYIRKNYNLLIGQTTAERIKMELGYAPIEHVTQTADIRGRDLLTGLPKTIQVSSTEIQSALAETLQRILEAIRNTLELCPPELSGDIVDRGIILSGGGSLLQGFRDWLVEEIDVPVHMAPSPLESVAIGTGRSLVFADKLAKN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_B_6(4CZJ)
?
[Raw transfer]




ANP_A_3(1JCG)
?
[Raw transfer]




ADP_A_3(4CZL)
?
[Raw transfer]




21 PsiBlast_CBE 97.4850%-102 - C4 -4CZJ 8.6 ?
2 PsiBlast_PDB 96.8450%-105 - C4 -4CZL 7.4 ?
22 PsiBlast_CBE 96.8350%-104 - C4 -4CZM - ? -
1 PsiBlast_PDB 96.3350%-100 - C4 -4CZE - ? -
5 PsiBlast_PDB 94.9748%-107 - C4 -2WUS - ? -
3 PsiBlast_PDB 94.3248% -99 - C4 -1JCF - ? -
4 PsiBlast_PDB 92.8248% -98 - C4 -1JCG 7.0 ?
7 PsiBlast_PDB 75.5625% -86 - C4 -2V7Y - DNAK_GEOKA -
9 PsiBlast_PDB 74.9823% -85 - C4 -3GL1 - HSP75_YEAST -
8 PsiBlast_PDB 73.8825% -89 - C4 -4ANI - DNAK_GEOKA -
57 Fugue 73.2225% -98 - C4 -1DKG - DNAK_ECOLI -
39 HHSearch 72.6125% -77 * C4 *2V7Y - DNAK_GEOKA -
36 HHSearch 69.5219% -79 - C4 -3D2F - ? -
41 HHSearch 69.3423% -81 - C4 -3I33 - HSP72_HUMAN -
40 HHSearch 66.5923% -84 - C4 -3QFU - GRP78_YEAST -
38 HHSearch 65.5018% -89 - C4 -1K8K - ARP3_BOVIN -
10 PsiBlast_PDB 64.9626% -91 - C4 -1DKG - DNAK_ECOLI -
34 HHSearch 63.3648% -28 - C4 -1JCE - ? -
35 HHSearch 62.6218% -90 - C4 -3DWL - ARP3_SCHPO -
6 PsiBlast_PDB 62.3247% -29 - C4 -1JCE - ? -