@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu00020: (2016-06-01 )
MKFTIQKDRLVESVQDVLKAVSSRTTIPILTGIKIVASDDGVSFTGSDSDISIESFIPKEEGDKEIVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYLTIIRSGKAEFNLNGLDADEYPHLPQIEEHHAIQIPTDLLKNLIRQTVFAVSTSETRPILTGVNWKVEQSELLCTATDSHRLALRKAKLDIPEDRSYNVVIPGKSLTELSKILDDNQELVDIVITETQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAESIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVRTY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

323_P_5(3D1F)
DPO3B_ECOLI
[Raw transfer]




LEU_A_3(4K3L)
DPO3B_ECOLI
[Raw transfer]




ACE_A_11(4K3L)
DPO3B_ECOLI
[Raw transfer]




25 HHSearch 98.7899%-132 - C2 -4TR6 - DPO3B_BACSU -
1 PsiBlast_PDB 98.22100%-128 - C2 -4TR6 - DPO3B_BACSU -
22 HHSearch 78.0637%-117 - C2 -2AVT - ? -
3 PsiBlast_PDB 77.6937%-113 - C2 -2AVT - ? -
2 PsiBlast_PDB 77.0141%-107 - C2 -2AWA - DPO3B_STRPN -
24 HHSearch 73.7334%-121 - C2 -3T0P - ? -
4 PsiBlast_PDB 70.9033%-117 - C2 -3T0P - ? -
12 PsiBlast_PDB 69.8426%-109 - C2 -3D1F Error DPO3B_ECOLI
21 HHSearch 69.2326%-111 - C2 -1VPK - ? -
23 HHSearch 69.2127%-113 - C2 -4K3L - DPO3B_ECOLI -
16 PsiBlast_PDB 68.8926%-116 - C2 -3Q4K - DPO3B_ECOLI -
27 HHSearch 68.8128%-106 - C2 -5AGV - DPO3B_MYCTU -
18 PsiBlast_PDB 68.7926%-113 - C2 -4K3L 3.7 DPO3B_ECOLI
8 PsiBlast_PDB 68.6426%-108 - C2 -1UNN - DPO3B_ECOLI -
9 PsiBlast_PDB 68.6226%-108 - C2 -1OK7 - DPO3B_ECOLI -
26 HHSearch 68.2427%-113 * C2 *4TR8 - ? -
14 PsiBlast_PDB 68.1726%-107 - C2 -3QSB - DPO3B_ECOLI -
5 PsiBlast_PDB 68.0126%-116 - C2 -3Q4L - DPO3B_ECOLI -
10 PsiBlast_PDB 67.9226%-109 - C2 -3BEP - DPO3B_ECOLI -
19 PsiBlast_PDB 67.7726%-109 - C2 -4K3M - DPO3B_ECOLI -