@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PF02569_PANC_M: (2014-09-30 )
MTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYRAILESHWRN

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FG6_A_3(3IVX)
PANC_MYCTU
[Raw transfer]




PAJ_A_6(1N2I)
PANC_MYCTU
[Raw transfer]




PAJ_A_7(1N2H)
PANC_MYCTU
[Raw transfer]




PAJ_B_7(1N2I)
PANC_MYCTU
[Raw transfer]




PAJ_B_8(1N2H)
PANC_MYCTU
[Raw transfer]




APC_A_7(1N2G)
PANC_MYCTU
[Raw transfer]




PAJ_A_3(3AG6)
PANC_STAA8
[Raw transfer]




A7D_A_3(3IOE)
PANC_MYCTU
[Raw transfer]




FG5_B_16(3IVG)
PANC_MYCTU
[Raw transfer]




A7D_B_9(3IOE)
PANC_MYCTU
[Raw transfer]




ATP_A_3(4G5Y)
PANC_MYCTU
[Raw transfer]




ATP_B_9(4G5Y)
PANC_MYCTU
[Raw transfer]




AMP_B_5(2A86)
PANC_MYCTU
[Raw transfer]




A5D_A_5(3IOC)
PANC_MYCTU
[Raw transfer]




FG6_B_14(3IVX)
PANC_MYCTU
[Raw transfer]




ATP_A_4(2A84)
PANC_MYCTU
[Raw transfer]




APC_A_6(1N2E)
PANC_MYCTU
[Raw transfer]




APC_A_6(1N2B)
PANC_MYCTU
[Raw transfer]




APC_B_7(1N2B)
PANC_MYCTU
[Raw transfer]




2B5_B_11(3LE8)
PANC_MYCTU
[Raw transfer]




FG3_A_3(3IUE)
PANC_MYCTU
[Raw transfer]




A6D_B_9(3IOD)
PANC_MYCTU
[Raw transfer]




APC_B_7(1N2E)
PANC_MYCTU
[Raw transfer]




AMP_A_4(2A86)
PANC_MYCTU
[Raw transfer]




A6D_A_3(3IOD)
PANC_MYCTU
[Raw transfer]




APC_B_8(1N2G)
PANC_MYCTU
[Raw transfer]




GOL_J_10(1N2J)
PANC_MYCTU
[Raw transfer]




AMP_A_3(2A7X)
PANC_MYCTU
[Raw transfer]




GOL_A_4(4DDK)
PANC_MYCTU
[Raw transfer]




FG4_A_3(3IVC)
PANC_MYCTU
[Raw transfer]




GOL_A_10(3IVG)
PANC_MYCTU
[Raw transfer]




GOL_B_7(1MOP)
PANC_MYCTU
[Raw transfer]




FG2_A_10(3IUB)
PANC_MYCTU
[Raw transfer]




GOL_A_3(3IVG)
PANC_MYCTU
[Raw transfer]




ATP_A_5(3INN)
PANC_BRUME
[Raw transfer]




GOL_A_4(2A7X)
PANC_MYCTU
[Raw transfer]




GOL_A_7(3COV)
PANC_MYCTU
[Raw transfer]




BAL_H_8(1N2J)
PANC_MYCTU
[Raw transfer]




A5D_B_6(3IOC)
PANC_MYCTU
[Raw transfer]




A4D_B_10(3IOB)
PANC_MYCTU
[Raw transfer]




GOL_B_21(4FZJ)
PANC_MYCTU
[Raw transfer]




GOL_A_5(2A84)
PANC_MYCTU
[Raw transfer]




FG3_B_18(3IUE)
PANC_MYCTU
[Raw transfer]




A8D_A_10(3ISJ)
PANC_MYCTU
[Raw transfer]




GOL_A_11(1V8F)
PANC_THET8
[Raw transfer]




A8D_B_15(3ISJ)
PANC_MYCTU
[Raw transfer]




AMP_A_3(3UK2)
PANC_BURTA
[Raw transfer]




GOL_A_2(3MXT)
PANC_CAMJE
[Raw transfer]




FMT_A_5(3MXT)
PANC_CAMJE
[Raw transfer]




AMP_A_5(3N8H)
PANC_FRATT
[Raw transfer]




0HN_B_7(4DDK)
PANC_MYCTU
[Raw transfer]




0HN_A_3(4DDK)
PANC_MYCTU
[Raw transfer]




GOL_A_6(3N8H)
PANC_FRATT
[Raw transfer]




MS0_A_5(4DDH)
PANC_MYCTU
[Raw transfer]




I2E_A_6(4EF6)
PANC_MYCTU
[Raw transfer]




0JD_B_8(4DE5)
PANC_MYCTU
[Raw transfer]




0JD_A_4(4G5F)
PANC_MYCTU
[Raw transfer]




15N_B_10(4G5F)
PANC_MYCTU
[Raw transfer]




I2E_B_17(4EF6)
PANC_MYCTU
[Raw transfer]




0W1_B_12(4FZJ)
PANC_MYCTU
[Raw transfer]




MS0_B_9(4DDH)
PANC_MYCTU
[Raw transfer]




0JD_A_3(4DE5)
PANC_MYCTU
[Raw transfer]




PAF_G_7(1N2J)
PANC_MYCTU
[Raw transfer]




PAF_F_6(1N2J)
PANC_MYCTU
[Raw transfer]




PAF_A_8(1N2B)
PANC_MYCTU
[Raw transfer]




EDO_A_9(4FZJ)
PANC_MYCTU
[Raw transfer]




EDO_A_7(4EF6)
PANC_MYCTU
[Raw transfer]




EDO_A_11(4FZJ)
PANC_MYCTU
[Raw transfer]




PAF_A_8(1N2E)
PANC_MYCTU
[Raw transfer]




0HO_B_9(4DDM)
PANC_MYCTU
[Raw transfer]




0HO_A_8(4DDM)
PANC_MYCTU
[Raw transfer]




PAF_A_5(3Q12)
PANC_YERPE
[Raw transfer]




BAL_E_5(1N2O)
PANC_MYCTU
[Raw transfer]




144_A_8(1V8F)
PANC_THET8
[Raw transfer]




0OC_B_11(4G5Y)
PANC_MYCTU
[Raw transfer]




EDO_A_4(1IHO)
PANC_ECOLI
[Raw transfer]




0OC_A_3(4EFK)
PANC_MYCTU
[Raw transfer]




0OC_B_10(4EFK)
PANC_MYCTU
[Raw transfer]




0OC_A_5(4G5Y)
PANC_MYCTU
[Raw transfer]




BAL_A_6(2A86)
PANC_MYCTU
[Raw transfer]




EOH_A_6(4DDK)
PANC_MYCTU
[Raw transfer]




EOH_A_12(1N2B)
PANC_MYCTU
[Raw transfer]




EOH_A_10(1N2H)
PANC_MYCTU
[Raw transfer]




EOH_B_11(1N2H)
PANC_MYCTU
[Raw transfer]




BAL_F_6(1N2O)
PANC_MYCTU
[Raw transfer]




ACY_A_4(3AG6)
PANC_STAA8
[Raw transfer]




PRO_A_3(3N8H)
PANC_FRATT
[Raw transfer]




51 PsiBlast_CBE 96.2099%-134 - C7 -1MOP 2.8 PANC_MYCTU
10 PsiBlast_PDB 96.0199%-131 - C7 -4DE5 3.9 PANC_MYCTU
4 PsiBlast_PDB 95.8999%-129 - C7 -3IVC 7.0 PANC_MYCTU
5 PsiBlast_PDB 95.5599%-132 - C7 -3IVG 3.5 PANC_MYCTU
48 PsiBlast_CBE 95.5399%-133 - C7 -1N2G 8.5 PANC_MYCTU
6 PsiBlast_PDB 95.4099%-131 - C7 -3IVX 7.7 PANC_MYCTU
17 PsiBlast_PDB 95.3999%-132 - C7 -1N2I 9.7 PANC_MYCTU
47 PsiBlast_CBE 95.3899%-131 - C7 -1N2H 9.4 PANC_MYCTU
8 PsiBlast_PDB 95.3699%-129 - C7 -4DDK 4.1 PANC_MYCTU
3 PsiBlast_PDB 95.3599%-129 - C7 -3IUE 7.6 PANC_MYCTU
30 PsiBlast_CBE 95.2599%-138 - C7 -3IUE 6.6 PANC_MYCTU
18 PsiBlast_PDB 95.1899%-128 - C7 -1N2J 2.9 PANC_MYCTU
11 PsiBlast_PDB 95.1699%-129 - C7 -4FZJ 2.4 PANC_MYCTU
14 PsiBlast_PDB 95.1299%-129 - C7 -1N2E 9.2 PANC_MYCTU
46 PsiBlast_CBE 95.0499%-129 - C7 -1N2I 9.7 PANC_MYCTU
16 PsiBlast_PDB 95.0299%-128 - C7 -1N2H 9.6 PANC_MYCTU
54 PsiBlast_CBE 95.0099%-132 - C7 -3IOE 7.8 PANC_MYCTU
38 PsiBlast_CBE 94.9199%-137 - C7 -3ISJ 5.0 PANC_MYCTU
9 PsiBlast_PDB 94.9199%-127 - C7 -4DDM 2.8 PANC_MYCTU
42 PsiBlast_CBE 94.8799%-128 - C7 -2A86 6.9 PANC_MYCTU
28 PsiBlast_CBE 94.8699%-137 - C7 -3IVG 7.4 PANC_MYCTU
15 PsiBlast_PDB 94.8699%-127 - C7 -1N2G 9.5 PANC_MYCTU
71 HHSearch 94.8499%-129 - C7 -3COV 2.4 PANC_MYCTU
27 PsiBlast_CBE 94.8399%-135 - C7 -3IVX 7.5 PANC_MYCTU
44 PsiBlast_CBE 94.8299%-133 - C7 -1N2O 3.8 PANC_MYCTU
7 PsiBlast_PDB 94.8099%-129 - C7 -4DDH 4.5 PANC_MYCTU
45 PsiBlast_CBE 94.7599%-129 - C7 -1N2J 3.4 PANC_MYCTU
35 PsiBlast_CBE 94.6299%-128 - C7 -4EF6 4.8 PANC_MYCTU
53 PsiBlast_CBE 94.6199%-128 - C7 -4G5Y 9.0 PANC_MYCTU
50 PsiBlast_CBE 94.6099%-133 - C7 -1N2B 8.7 PANC_MYCTU
49 PsiBlast_CBE 94.5899%-132 - C7 -1N2E 8.8 PANC_MYCTU
31 PsiBlast_CBE 94.5799%-133 - C7 -3IUB - PANC_MYCTU
23 PsiBlast_CBE 94.5499%-136 - C7 -4DE5 4.1 PANC_MYCTU
22 PsiBlast_CBE 94.4499%-134 - C7 -4FZJ 4.3 PANC_MYCTU
19 PsiBlast_PDB 94.4499%-134 - C7 -1N2O 3.3 PANC_MYCTU
12 PsiBlast_PDB 94.4199%-127 - C7 -1MOP - PANC_MYCTU
13 PsiBlast_PDB 94.4099%-128 - C7 -1N2B 8.1 PANC_MYCTU
1 PsiBlast_PDB 94.3699%-133 - C7 -4G5F 3.7 PANC_MYCTU
55 PsiBlast_CBE 94.3499%-130 - C7 -3IOE 7.6 PANC_MYCTU
24 PsiBlast_CBE 94.3099%-135 - C7 -4DDM 3.0 PANC_MYCTU
36 PsiBlast_CBE 94.2999%-136 - C7 -3LE8 8.3 PANC_MYCTU
2 PsiBlast_PDB 94.2399%-128 - C7 -3IUB 6.2 PANC_MYCTU
32 PsiBlast_CBE 94.2299%-135 - C7 -4EFK 2.8 PANC_MYCTU
41 PsiBlast_CBE 94.1799%-133 - C7 -2A86 6.9 PANC_MYCTU
25 PsiBlast_CBE 94.1699%-131 - C7 -4DDK 4.0 PANC_MYCTU
39 PsiBlast_CBE 94.0899%-128 - C7 -3ISJ 4.9 PANC_MYCTU
34 PsiBlast_CBE 93.9099%-133 - C7 -4EF6 4.3 PANC_MYCTU
60 PsiBlast_CBE 93.8099%-133 - C7 -3IOB 6.2 PANC_MYCTU
26 PsiBlast_CBE 93.8099%-135 - C7 -4DDH 5.0 PANC_MYCTU
56 PsiBlast_CBE 93.7999%-137 - C7 -3IOD 9.8 PANC_MYCTU
58 PsiBlast_CBE 93.6099%-136 - C7 -3IOC 8.5 PANC_MYCTU
52 PsiBlast_CBE 93.5799%-137 - C7 -4G5Y 9.1 PANC_MYCTU
33 PsiBlast_CBE 93.5299%-130 - C7 -4EFK 3.4 PANC_MYCTU
57 PsiBlast_CBE 93.4999%-128 - C7 -3IOD 7.9 PANC_MYCTU
21 PsiBlast_CBE 93.3199%-134 - C7 -4G5F 3.9 PANC_MYCTU
43 PsiBlast_CBE 93.2099%-134 - C7 -2A84 9.9 PANC_MYCTU
20 PsiBlast_PDB 93.1499%-133 - C7 -2A7X 7.0 PANC_MYCTU
59 PsiBlast_CBE 92.1999%-131 - C7 -3IOC 8.1 PANC_MYCTU
72 HHSearch 72.6143%-114 - C7 -3INN 7.5 PANC_BRUME
77 HHSearch 70.7645%-113 - C7 -3Q12 2.7 PANC_YERPE
73 HHSearch 70.7248%-122 - C7 -1V8F 2.3 PANC_THET8
78 HHSearch 70.3445%-121 - C7 -3UK2 6.5 PANC_BURTA
76 HHSearch 70.2837%-115 - C7 -3MXT 3.0 PANC_CAMJE
74 HHSearch 69.8840%-111 - C7 -3AG6 9.1 PANC_STAA8
61 Fugue 69.4244%-121 - C7 -1IHO 3.2 PANC_ECOLI
79 HHSearch 66.3537%-116 - C7 -3N8H 6.3 PANC_FRATT